KEGG   Ashbya gossypii (Eremothecium gossypii): AGOS_ADL206WHelp
Entry
AGOS_ADL206W      CDS       T00167                                 

Definition
ADL206Wp
Orthology
K04709  
Acyl-CoA-dependent ceramide synthase [EC:2.3.1.24]
Organism
ago  Ashbya gossypii (Eremothecium gossypii)
Pathway
Sphingolipid metabolism
Metabolic pathways
Module
Ceramide biosynthesis
Brite
KEGG Orthology (KO) [BR:ago00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    AGOS_ADL206W
Enzymes [BR:ago01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.24  sphingosine N-acyltransferase
     AGOS_ADL206W
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
IV:340998..342116
Genome map
AA seq 372 aa AA seqDB search
MSGQVRQRFAKDQHAGSQIEVEYGSKDAAFEADKSVELEEREELLPIRGQLAVSKVDLYT
VYASGALLVALAVGFLRQAAWCDKFLRLQYASVESPGKYDIGIDDAYIVGTFVVVLCLVR
SSLLEFVLKPLAHYKFRISSGKIQQRYGEQSWSMLYYTASWVTGFYLYYHSPYFLNCDHI
YLNWPHDKMAGVFKVYYLVQIASWLQQIIVLNVEEKRKDYWQMFAHHIITVALTTGSYYY
YFNRIGHVILIIMDVVDILLSSAKILKYCGFSVACDYMFVVFLGFWVVLRHGVYNYILHH
AWAKSRGLMQNQRCGVHAPGTRCWTPLVIDIFVLLLAGLQLITVIWSFLIVKVFMKVIRG
SGAEDVRSDDEE
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atgtcgggccaagtcaggcagaggttcgctaaggaccagcacgcgggatcgcagatcgag
gtcgagtacgggagcaaggatgcagcattcgaggcggacaagtctgtcgagctcgaagag
cgggaagaactcctgcccatcagagggcagctggccgtgagcaaggtcgacttgtacacg
gtctacgcgtcgggcgcgctgctggtggcactggctgttggttttctgcggcaggctgca
tggtgcgacaagtttctgaggctccagtacgcgagcgtggagtcgccggggaagtacgac
atagggatagacgatgcctacatcgtcggcacgttcgtggtcgtgctgtgcctggtccgc
tcgagcctgctggagtttgtgctcaagccgctcgcgcactacaagttccggatctcgtcg
ggtaagatacaacagcgatacggcgagcagagttggtcgatgctgtactacaccgcgtcg
tgggtgacgggcttctacctgtactaccactcgccctacttcctgaactgcgaccacatc
tatctgaactggccgcacgacaagatggccggcgtcttcaaggtgtactacctggtgcag
atcgcatcgtggctgcagcagatcatcgtgctcaacgtggaggagaagcgcaaggactac
tggcagatgtttgcgcaccacataatcacggtcgcgctgaccacggggtcgtactactat
tacttcaaccgcattggccatgtgattctgattatcatggacgtggtcgatatcttgctc
tccagcgccaagatcctgaagtactgtggcttctctgttgcctgtgactacatgtttgtc
gttttcctgggcttctgggtcgtgttgaggcacggggtgtacaattacattctacaccac
gcgtgggccaagtcgcgagggctcatgcagaaccagcggtgcggggtacacgcccctggc
acgcgctgctggactccgctggtgatcgatatctttgtgctcctactggcagggttgcaa
ctgatcacagtgatctggtctttcctcattgtcaaagtatttatgaaagttatcagggga
agcggtgcagaggatgtgcgcagtgatgacgaggaatag

DBGET integrated database retrieval system