KEGG   Ashbya gossypii (Eremothecium gossypii): AGOS_ADL216CHelp
Entry
AGOS_ADL216C      CDS       T00167                                 

Definition
ADL216Cp
Orthology
K11407  
histone deacetylase 6/10 [EC:3.5.1.98]
Organism
ago  Ashbya gossypii (Eremothecium gossypii)
Brite
Enzymes [BR:ago01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     AGOS_ADL216C
Protein phosphatases and associated proteins [BR:ago01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     AGOS_ADL216C
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
IV:complement(324645..326753)
Genome map
AA seq 702 aa AA seqDB search
MEERTQQKRKLEEGSPDGEANGGQASRKAIVQKRPVIVPPVRPKISYVPLKTGLCYDVRM
RYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIEDPTLSGIDEIGELMQKIPVREA
TEEEILTVHSKEHVEFLKTTNTMDREQLLKETEAGDSVYYNNDSLISARLSCGGAIEACK
AVVEGRVKNAMAVVRPPGHHAEPGVAGGFCLFSNVAVAAQNILKNYPESVRRVMILDWDI
HHGNGTQKAFYGDNRVLYVSLHRYELGKYYPGTSYGNYDQCGDGKGEGFNCNIPWSCSGV
GDAEYMWAFEQVVIPMGREFQPDLVIISSGFDAADGDTIGQCHVSPACYGHLTHMLKSLA
RGNMCVVLEGGYNLDSIAKSALGVAKVLIGEPPDELPQPLKQPKPEAIVTIDMVIKEQSK
YWNCFKGRHGNDGINWREGVNDSLTSKNFPLQSAVRQHQFRRLAKEYKFVTLPLLNMELP
SDTIICSPNIHTTDAIIICVHDTPEIWAQRDSLTGHIDPSTSIIVDTTVSVINWALGRNY
GVIDINIPQSLFEQDNYSAVLSSQEVVTYLWDSYLKTFPHLARVAFVGIGDAYSGFVHLL
GHRDTRSVVKCAIAFADKKQLRPLVPLVDESLGDWYFKNSLVFTSTYHPCWGTDGNDSKK
PRKKFGRVLRCTCDGMNNIVEERLEEATDFILDSFEEWSESE
NT seq 2109 nt NT seq  +upstreamnt  +downstreamnt
atggaagagcggacacaacaaaaacggaaactggaagagggcagcccggacggcgaggct
aacggagggcaggcgagccggaaggccatagtgcagaagcggcctgttattgtacccccg
gtgcggccgaagatctcatatgtgccgcttaagacaggcctttgctacgacgtgcgaatg
cgctaccacgccaagatatttacgtcttactttgagtacatagatccacaccccgaggat
ccacggcggatttaccggatctacaaaatactggcggagaacgggctgattgaggacccg
actttgagcgggattgacgaaattggagagctgatgcagaagatccctgtgcgggaggcg
acggaggaggagattctgaccgtgcactcgaaggagcacgtcgagttcctgaagactaca
aacacgatggaccgcgaacagctgctgaaggagacggaggccggggacagcgtgtattac
aacaacgactcgctgatcagcgcgagactctcgtgcggaggggcaatcgaggcgtgcaaa
gctgtggtggagggccgtgtgaagaatgcgatggcagtcgtgcgcccaccagggcaccat
gcagagcctggagtggcaggcggcttttgcctgttcagcaatgttgctgtcgcagcgcag
aacatcttgaaaaattacccagagagcgttcgcagagttatgattttagactgggatatt
caccatggcaatggcactcagaaggcattttacggcgataaccgtgttttgtatgtttct
cttcacagatatgagctagggaagtattatcctgggacatcttatggtaactacgatcaa
tgcggcgacggcaagggcgaaggtttcaattgcaacattccatggtcatgcagcggggtt
ggcgatgcagagtacatgtgggcgtttgagcaggtagtgatcccaatggggcgtgagttc
cagccagatctggtaatcatctcatccggttttgatgctgctgacggagacaccattggc
cagtgccatgtatcacccgcgtgctatggacatctgacacatatgctaaagtcgttggcg
aggggtaacatgtgtgtggtgctcgaaggcggttacaatctcgattccatcgcaaagagt
gcactaggcgtcgcaaaagttcttataggcgagccaccagacgagttgccacagcctctt
aaacaaccaaagccagaagcaattgtaacgattgacatggttataaaagaacagtcaaaa
tattggaattgcttcaaaggcagacatggaaatgatggcattaactggagagagggcgtg
aacgattcgcttacgagcaagaattttccattacagagtgctgttcgccaacaccaattc
aggcgacttgcaaaagagtataaatttgtgacattgccattgctgaatatggagcttccc
tcagacactattatttgctctcctaacatacatactaccgatgcaattattatatgtgtg
catgacaccccggagatctgggcgcagcgcgattcactaacaggtcatattgacccctct
acatctatcatagtggataccaccgtctcagtcataaattgggccttaggaaggaactat
ggcgtgatcgacattaacataccacaatcccttttcgaacaagacaactattcagccgtc
ctttcttcacaggaggtggttacttatttatgggatagctacctgaaaaccttcccacac
ttggcgagggttgcttttgtaggaattggggacgcgtatagtggatttgtccatttgtta
ggccatagggacacgcgcagtgttgtaaaatgtgccattgcctttgcggataaaaagcag
ttacgcccactcgtgcctttggtcgacgaatctctaggcgattggtactttaagaattcc
ttggtattcaccagcacttatcatccatgctgggggaccgatgggaatgactccaagaaa
cccagaaaaaagttcggacgagtactgcgatgtacttgtgatggcatgaacaatattgtg
gaggaaagacttgaagaagctactgatttcattctagattcctttgaagaatggagcgag
tccgaatga

DBGET integrated database retrieval system