KEGG   Ashbya gossypii (Eremothecium gossypii): AGOS_ADL225WHelp
Entry
AGOS_ADL225W      CDS       T00167                                 

Definition
ADL225Wp
Orthology
K01178  
glucoamylase [EC:3.2.1.3]
Organism
ago  Ashbya gossypii (Eremothecium gossypii)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:ago00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
IV:310366..312186
Genome map
AA seq 606 aa AA seqDB search
MDKIQTTYTGRRSRSQWVRSPWTLTVVSLAIIWFFHDAFLSFGAANAGSGGETAAAAIWD
FFRSAETVTVVDFNNRAAAPAGSLQRRLRLRDITPGTISRGDFGKWVQEEAVISKERLLA
NIADMNLNNNLHSALGVAEGAPLASPSRVRPNYFYQWVRDGAITINTITNTILDHPGDFN
ITLAGTVIKYLKNVYVLQRLDNPSGRFDEDLSGLGEPKFMVDNTAFNSPWGRPQNDGPAL
RAITTMNFLQRLNSQGMSLEYVLKRYRLEYGQESLEVPFQNEQELFDKVLYYDLMFIIKN
WEKEGFDLWEEVVGIHFFTALCQLKALKMAEYLLTKGVLHPDEALLSILRETIGRMTTYI
SRDGGFINPHINFIVSTPRLLGQRSGLDIGTLIGSILTHDELGSDDVPAVAIPFNVDHPA
ILNVLYELTTRMLKLYPINHDRVNLNMGVGLGRYPEDVYNGYDTSEGNPWFLATSTAAEL
LYKLIYRHHIASQDLVVDLDGDNWQSAFWNLIFDGLRPTSNGGSSTLVIPYGSQAFNQTM
GAVFNYADSFLDKIRLHVSDCGEMSEQFNKYTGFLEGARDLSWSYGSFLNSLRWRSAAYQ
LLSSQE
NT seq 1821 nt NT seq  +upstreamnt  +downstreamnt
atggataagattcagacgacatacacgggccgtcgttcgcggagtcaatgggtgcgttca
ccatggactctcactgttgtcagcctagctatcatctggtttttccatgacgcgtttctt
tcgtttggagcagccaatgcgggcagtggcggcgagacggcggcggccgccatctgggac
ttctttcggtctgcggagacagtcacggtggtggacttcaataacagggcggcggcacct
gcagggtcgttgcagcggcggcttcggttgcgcgatatcacgcccggtaccatttccaga
ggcgacttcggcaagtgggtgcaggaggaggctgtcattagcaaggagcgtcttttggcg
aacattgcagatatgaacttgaataacaacttgcattctgccttgggtgtggcggagggg
gcgccgctcgcgtctccttctcgggtgcggcccaactatttctatcagtgggtgcgagat
ggagcgattaccatcaacacaattaccaataccatactcgatcatcctggggacttcaac
atcacgctagcagggactgtgatcaagtatctaaagaacgtttatgtattgcaacgcctc
gacaatcccagtggtcgttttgacgaagacctttccgggttaggggaacctaagttcatg
gtagacaatactgcgttcaacagcccgtggggtagacctcagaacgatgggccggcattg
agggcgatcactaccatgaatttcttgcagcggctcaattctcaaggcatgtccctagaa
tacgtactcaagcgctatagactggaatacggacaagaatctctcgaagtaccttttcag
aacgaacaggaattgtttgacaaagtgctttactatgacttgatgtttataattaagaac
tgggagaaggagggctttgatctatgggaagaggtggtcggtattcacttcttcacggct
ttgtgtcaactcaaggccctcaagatggccgaataccttctgaccaaaggcgtgctccac
ccggacgaggccttactttcaattctccgtgagacgattgggaggatgacaacatacatt
tcacgagacggcggttttattaatccacacattaactttattgtatctacgccccgccta
ttgggccagcgctctggcttagatattgggaccttaattggaagtattttgactcatgat
gaacttggctcggatgatgttccagcagttgccattccgttcaatgtggaccatcctgct
attctcaacgttctttacgaattaactacgcggatgctgaaattgtatccgatcaaccac
gatagagtgaatttgaacatgggtgttgggctaggcagatatcccgaggatgtttacaac
ggttatgatacctccgagggcaacccgtggtttttagctacgtcaactgcggcggagttg
ttgtataaacttatctaccggcaccacatcgcctctcaagaccttgtggttgacttggac
ggggacaactggcagtcagcattctggaacttaatcttcgacggactccgccccacctcg
aatggcggcagttctactttagttattccctacgggtctcaggccttcaaccagacaatg
ggtgcggtcttcaactacgcagactcattcttggacaaaatcaggctccatgttagcgac
tgtggtgagatgagcgagcagttcaataagtataccggctttttggagggcgcacgcgac
ttgtcatggtcctatggttcgttcttaaactcactccgctggcgctctgctgcctaccag
cttctcagctcacaagaatag

DBGET integrated database retrieval system