KEGG   Ashbya gossypii (Eremothecium gossypii): AGOS_ADL225WHelp
Entry
AGOS_ADL225W      CDS       T00167                                 

Definition
ADL225Wp
Orthology
K01178  
glucoamylase [EC:3.2.1.3]
Organism
ago  Ashbya gossypii (Eremothecium gossypii)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ago00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    AGOS_ADL225W
Enzymes [BR:ago01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     AGOS_ADL225W
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
IV:310366..312186
Genome map
AA seq 606 aa AA seqDB search
MDKIQTTYTGRRSRSQWVRSPWTLTVVSLAIIWFFHDAFLSFGAANAGSGGETAAAAIWD
FFRSAETVTVVDFNNRAAAPAGSLQRRLRLRDITPGTISRGDFGKWVQEEAVISKERLLA
NIADMNLNNNLHSALGVAEGAPLASPSRVRPNYFYQWVRDGAITINTITNTILDHPGDFN
ITLAGTVIKYLKNVYVLQRLDNPSGRFDEDLSGLGEPKFMVDNTAFNSPWGRPQNDGPAL
RAITTMNFLQRLNSQGMSLEYVLKRYRLEYGQESLEVPFQNEQELFDKVLYYDLMFIIKN
WEKEGFDLWEEVVGIHFFTALCQLKALKMAEYLLTKGVLHPDEALLSILRETIGRMTTYI
SRDGGFINPHINFIVSTPRLLGQRSGLDIGTLIGSILTHDELGSDDVPAVAIPFNVDHPA
ILNVLYELTTRMLKLYPINHDRVNLNMGVGLGRYPEDVYNGYDTSEGNPWFLATSTAAEL
LYKLIYRHHIASQDLVVDLDGDNWQSAFWNLIFDGLRPTSNGGSSTLVIPYGSQAFNQTM
GAVFNYADSFLDKIRLHVSDCGEMSEQFNKYTGFLEGARDLSWSYGSFLNSLRWRSAAYQ
LLSSQE
NT seq 1821 nt NT seq  +upstreamnt  +downstreamnt
atggataagattcagacgacatacacgggccgtcgttcgcggagtcaatgggtgcgttca
ccatggactctcactgttgtcagcctagctatcatctggtttttccatgacgcgtttctt
tcgtttggagcagccaatgcgggcagtggcggcgagacggcggcggccgccatctgggac
ttctttcggtctgcggagacagtcacggtggtggacttcaataacagggcggcggcacct
gcagggtcgttgcagcggcggcttcggttgcgcgatatcacgcccggtaccatttccaga
ggcgacttcggcaagtgggtgcaggaggaggctgtcattagcaaggagcgtcttttggcg
aacattgcagatatgaacttgaataacaacttgcattctgccttgggtgtggcggagggg
gcgccgctcgcgtctccttctcgggtgcggcccaactatttctatcagtgggtgcgagat
ggagcgattaccatcaacacaattaccaataccatactcgatcatcctggggacttcaac
atcacgctagcagggactgtgatcaagtatctaaagaacgtttatgtattgcaacgcctc
gacaatcccagtggtcgttttgacgaagacctttccgggttaggggaacctaagttcatg
gtagacaatactgcgttcaacagcccgtggggtagacctcagaacgatgggccggcattg
agggcgatcactaccatgaatttcttgcagcggctcaattctcaaggcatgtccctagaa
tacgtactcaagcgctatagactggaatacggacaagaatctctcgaagtaccttttcag
aacgaacaggaattgtttgacaaagtgctttactatgacttgatgtttataattaagaac
tgggagaaggagggctttgatctatgggaagaggtggtcggtattcacttcttcacggct
ttgtgtcaactcaaggccctcaagatggccgaataccttctgaccaaaggcgtgctccac
ccggacgaggccttactttcaattctccgtgagacgattgggaggatgacaacatacatt
tcacgagacggcggttttattaatccacacattaactttattgtatctacgccccgccta
ttgggccagcgctctggcttagatattgggaccttaattggaagtattttgactcatgat
gaacttggctcggatgatgttccagcagttgccattccgttcaatgtggaccatcctgct
attctcaacgttctttacgaattaactacgcggatgctgaaattgtatccgatcaaccac
gatagagtgaatttgaacatgggtgttgggctaggcagatatcccgaggatgtttacaac
ggttatgatacctccgagggcaacccgtggtttttagctacgtcaactgcggcggagttg
ttgtataaacttatctaccggcaccacatcgcctctcaagaccttgtggttgacttggac
ggggacaactggcagtcagcattctggaacttaatcttcgacggactccgccccacctcg
aatggcggcagttctactttagttattccctacgggtctcaggccttcaaccagacaatg
ggtgcggtcttcaactacgcagactcattcttggacaaaatcaggctccatgttagcgac
tgtggtgagatgagcgagcagttcaataagtataccggctttttggagggcgcacgcgac
ttgtcatggtcctatggttcgttcttaaactcactccgctggcgctctgctgcctaccag
cttctcagctcacaagaatag

DBGET integrated database retrieval system