KEGG   Ashbya gossypii (Eremothecium gossypii): AGOS_ADL274WHelp
Entry
AGOS_ADL274W      CDS       T00167                                 

Definition
ADL274Wp
Orthology
K03144  
transcription initiation factor TFIIH subunit 4
Organism
ago  Ashbya gossypii (Eremothecium gossypii)
Pathway
Basal transcription factors
Nucleotide excision repair
Module
Holo-TFIIH complex
Brite
KEGG Orthology (KO) [BR:ago00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    AGOS_ADL274W
  Replication and repair
   03420 Nucleotide excision repair
    AGOS_ADL274W
Transcription machinery [BR:ago03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     AGOS_ADL274W
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
IV:223319..224863
Genome map
AA seq 514 aa AA seqDB search
MEPTPGIIHDGHNLFKNTVNEYLQELPQPVQSRLYQSPATCLAIYRLLSPMAKFFIMSMI
FQDEEVSLRDLDRWVKPDAKFQLHDAIKSMKLLHLITEGRSGQPLMVQLNSIFKESFKNA
LTGGEVKNSFGNVVEEENDPVTMAMLDSYAADKWETILHFMVGTPLTKSPGKNVLSLLRH
SKLMEVDESSKELKITNEGFQFLLQDANAQIWTLLLQYLTMAETFQMDPVDVLNLIFMIG
ALELGKAYSVVGLSETQKTMLQDLRDYGLVFQKQSNLSKFYPTRLATMLTSDVVSIRSAS
GAVNSVLRQRAEGVDGKVLNGTALGDDDLQAGGEGALDGALIVETNFKLYSYSNSPLQIA
ILSLFIHLKTRFQNMVTGQITRESIRRALHNGITADQIIAYMETHAHPQMRRLAGDNLEK
KLELDPNCRDTLQVLPPTVVDQIKLWQLELDRIISYDGYLFRDFDNLQEYQVLAQYARDI
GVLLWSDDKKKMFFVSKEGNAQVIDFHKRKFRKK
NT seq 1545 nt NT seq  +upstreamnt  +downstreamnt
atggaacccactccagggatcattcatgatggtcacaatctcttcaaaaatacagttaat
gagtatcttcaggagcttcctcagcctgtgcaatctcgtctgtaccaatctccagcaaca
tgtcttgcaatataccgtcttttgtccccaatggccaaattcttcatcatgtctatgatc
tttcaggatgaagaagtttccctcagggacctggatcgttgggtaaaaccggacgcaaag
ttccagcttcatgacgctatcaagtccatgaagcttcttcatttaatcacagaggggcgc
tcaggacagcctcttatggtacagctgaactcaatctttaaagagtcgtttaagaacgca
ctcaccggcggcgaggtgaagaactcattcggcaacgttgtggaggaggagaacgaccct
gtgaccatggcaatgctagattcctacgctgcagacaagtgggagaccatattgcacttc
atggttggcacgccgctaactaaaagtccgggaaagaacgtacttagtctgttgagacac
agcaagctcatggaggtggatgagtcttcgaaagaactgaagatcacaaacgagggcttt
cagtttcttttgcaggatgctaatgcacagatatggacgttgctgctccagtatttgact
atggcagagacattccagatggatcctgtggacgttttgaatcttatattcatgattggt
gccctagaattaggaaaagcatacagcgttgtaggtctgagtgagactcaaaaaactatg
cttcaagatttaagagattacggtcttgtgttccagaagcaatcgaacttatcaaagttc
tacccaacgaggctggcgaccatgctgacatctgatgtcgtctctatccgttcagcatcc
ggtgctgtcaatagtgtactaagacagcgcgcagagggagtggatggcaaggttctcaac
gggactgcgcttggtgatgatgatcttcaggccggtggcgaaggtgcccttgacggcgct
ttaatcgtagaaaccaacttcaaactgtacagttattcgaactctccactacaaattgca
atcttgagtttgttcatacaccttaagacgcgttttcaaaatatggttacagggcagata
actagagagtctattagacgtgcgctacacaacggtataactgcagatcagataatagca
tatatggagacgcatgcacatcctcagatgcgtcgtctggcaggggataacttggagaaa
aagttggagctggaccctaactgcagagatacactacaggtgttaccgccaacagttgtt
gaccagataaaactatggcagttagaattggatcggatcataagttatgatgggtatctc
ttcagggattttgataatctacaggagtaccaggttctagctcaatacgcccgcgacatc
ggagtccttctttggagcgatgacaagaagaagatgttcttcgtttccaaagaaggcaat
gcacaagttatcgatttccacaagagaaaattccgcaagaagtag

  All links  
No link information was found.   
DBGET integrated database retrieval system