KEGG   Ashbya gossypii (Eremothecium gossypii): AGOS_ADL315CHelp
Entry
AGOS_ADL315C      CDS       T00167                                 

Definition
ADL315Cp
Orthology
K08293  
mitogen-activated protein kinase [EC:2.7.11.24]
Organism
ago  Ashbya gossypii (Eremothecium gossypii)
Brite
Enzymes [BR:ago01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     AGOS_ADL315C
Protein kinases [BR:ago01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [Table]
   AGOS_ADL315C
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
IV:complement(146549..147853)
Genome map
AA seq 434 aa AA seqDB search
MPLLQQNPPIQPPYSRASQKLKSLLSSYGENTSTTTAAKEMNGIAPMNLIEKSVVHPPRT
IYTKANFSIPGHYEVLQMLGKGSYGTVVSAIDNLNANYPIRIAIKKITNIFQREVLLKRA
IRELKFMHYFKGHKNIVSLINLEIVNEKPYDGLYCYQELIDYDLARVIHSNVQFSEFHIK
HFTYQILCGVKYIHSADVIHRDLKPGNILCSISGQLKICDFGLARGISPLFTNTKTSNHI
TNYVATRWYRAPELILSHKRYNKSIDMWAIGCILAEFYGRKPIFMGQDSMHQISEIVKVL
GTPSRDTIIKYGSSRAYDIFCPPKPQYAKIPWAEIYPFAGPDALDLIERLLDWDPDRRLT
VEEAIEHDFVKSVRDVNDEPCCPHGPFNFSYEAEFKSMSNLREVLYAEVKQFQEECATKD
VVPSLPIPQQIYPI
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgccactattgcaacagaacccccccattcagccaccctacagtcgtgcatcacagaaa
ttgaaaagcttgctaagctcgtatggtgaaaatactagcacaactacagccgccaaggaa
atgaacggaatagctcccatgaacttaatagagaaatcagtggtgcatccgcctaggacc
atatacaccaaggcaaacttctccatcccgggccactatgaagtgctccagatgttgggg
aagggatcatacggaacagttgtctcagctatcgataacctcaacgctaactaccccatt
cgcattgctattaaaaaaatcacgaacatattccagcgggaggtgttgttgaaacgtgcc
atccgtgagctaaaattcatgcactacttcaaagggcataagaatatcgtgtcgctcatc
aaccttgagatcgtcaacgaaaaaccgtacgacgggctctattgctatcaagaattaata
gactacgacttggctcgtgtcatccattccaacgtccaattctccgaatttcacatcaag
cacttcacctaccagatactctgcggcgtgaaatacatccacagcgcagacgtcatacac
cgcgacctcaagcctggcaatatattatgtagcatttccggccagttgaagatctgtgac
ttcggcttagcccgggggatctcgccgcttttcactaacacaaaaacctcgaaccatatc
accaactatgttgcaaccaggtggtatagagctcctgaattgatcttgtcgcataaaagg
tataacaaatccatagacatgtgggccataggctgcatcctcgcggagttctacggcagg
aagcccatattcatgggtcaggactccatgcaccaaatctcggagatcgtcaaggtcttg
ggtactccttccagagacacaatcatcaaatatggctcctccagagcatacgacatattc
tgcccccccaagccacagtatgccaagatcccctgggccgagatctatccgtttgccggc
ccagatgccctcgacctcatcgagcgcttgctagactgggatcccgaccgcagactcacc
gtggaagaggcgatagagcacgattttgtcaaatctgtgcgcgacgtcaacgacgagccc
tgctgtccacacggaccctttaacttctcctacgaagcagaattcaagtccatgtcgaac
cttcgcgaggtactctacgcagaggtgaagcagttccaggaagagtgcgccaccaaagat
gttgtaccatcgcttcctatcccacaacagatctatcccatttaa

DBGET integrated database retrieval system