KEGG   Ashbya gossypii (Eremothecium gossypii): AGOS_ADR021WHelp
Entry
AGOS_ADR021W      CDS       T00167                                 

Definition
ADR021Wp
Orthology
K08967  
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
ago  Ashbya gossypii (Eremothecium gossypii)
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Module
Methionine salvage pathway
Class
Metabolism; Amino acid metabolism; Cysteine and methionine metabolism [PATH:ago00270]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
IV:743735..744265
Genome map
AA seq 176 aa AA seqDB search
MVEAYVHDNNTHVDCRAPHHSGKSVSLERLASLGVFYRHCRSQDEVDAVACARHYSNRDE
VTISPASFPSEDAFRDKLAVFYTEHLHEDEEIRYALAGEGYFDLRDATTGDWIRVKLTTG
DLLIVPAGIYHRFTVTESNFIRAQRLFKDEPKWQAFNRPEGDARPVHKEYLASLAI
NT seq 531 nt NT seq  +upstreamnt  +downstreamnt
atggtggaagcctacgtgcacgacaacaacacccatgtggactgccgcgcgccgcaccac
agcggcaagtcagtctcgctggaacgcctcgcgagcctaggcgtgttctaccgccactgc
cgcagccaggatgaagtggacgctgttgcttgtgcccgccactacagcaaccgggacgag
gtgaccatctcgccggccagttttccgtccgaggacgcgttccgcgataagctcgcggtg
ttctacacagagcatctgcacgaagacgaggaaatccgctacgccctcgcaggcgagggc
tacttcgacttgcgtgacgccaccacgggcgactggatccgcgtgaaactcacgacgggc
gacctactgatcgtgcccgccggcatctaccaccgtttcaccgtgacagagtccaacttc
atccgcgcccagcgccttttcaaagacgaaccgaagtggcaggccttcaaccgcccagaa
ggcgatgcacgcccagtccacaaggagtaccttgcctctttagcgatatag

DBGET integrated database retrieval system