KEGG   Ashbya gossypii (Eremothecium gossypii): AGOS_ADR317CHelp
Entry
AGOS_ADR317C      CDS       T00167                                 

Definition
ADR317Cp
Orthology
K08866  
serine/threonine-protein kinase TTK/MPS1 [EC:2.7.12.1]
Organism
ago  Ashbya gossypii (Eremothecium gossypii)
Pathway
Cell cycle - yeast
Brite
KEGG Orthology (KO) [BR:ago00001]
 Cellular Processes
  Cell growth and death
   04111 Cell cycle - yeast
    AGOS_ADR317C
Enzymes [BR:ago01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     AGOS_ADR317C
Protein kinases [BR:ago01001]
 Serine/threonine protein kinases: Other group
  TTK family
   AGOS_ADR317C
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
IV:complement(1263470..1265929)
Genome map
AA seq 819 aa AA seqDB search
MRELGTSQQYLRPASSCSQSGSVNQLLRRPQLHLNSDSDDDHPLGPPKLSNFGSALLTDK
ENETPTYLRRSGTSLQGGNATATSGHTKPSTFTGTMNTEDSHSTLFSSMSKHQPSMTTVD
AERTAPGDDGLSSHRYQVIQQSMKDEILSRQGTRRSRRFITSRLATLGPAKRNSTTTNFE
FSSNISHDESRDVSHQEGNVSTSSNSNSGVLNNNGYNVFLDTEERARHDDKESHSAARQS
GLSDYGNISFGDLNPYQYLKKHNLPTSELPNISRIYFEMQKRENRRAAVRKNVLNGSGGQ
VAQLPTNNSAIASTAVALKEANGIASISSGSNKLTPPQAANSMIKRDRQPRRKHSDASVS
SFSKLLSSPISAGAPNYADSQKHTPVQKNSTPYEPLLINQNTKKREALNSLDVNANRHPS
IITKKQKVDELHDYLKKAPAAASVKKVEIVEPVRDPVITTIPLKPPSAEVPANVHQLPQR
KRQVITVNGSEYEKVELLGRGGSSKVYKVRNSSNRIYALKRVSFDEFDDASADGFKGEIE
LLKKLENQTRVVKLIDHEMNHGVLYVVMECGDHDLSQVLAQRSSMPLDIEFVRYHAQEML
KCVKVVHDAGIVHSDLKPANFVFVKGILKIIDFGIANAVPDHTVNIYRDTQIGTPNYMAP
EALVAMNYTQDSDQIQQEMHHNRWKVGKPSDIWSCGCIMYQMIYGKPPYGSFQGQNRLLA
IMNPEVKIVYPEKTPTGDFVPRTALDTIKACLERNPERRWTVDELLRGPFIKPITVTHFF
IRDLIKNAVKYGSDQRYVSKEKVEDLADDVWHRLSDFRL
NT seq 2460 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgagttgggcacttcacagcagtatctccggccggcgagcagctgctcgcaaagc
gggagcgtcaatcagcttctccgcaggccccagctgcatttaaacagcgactctgatgac
gaccaccccctgggaccaccgaagttgagcaactttgggtcggcgttgctcacggacaag
gagaacgaaaccccgacctatctgaggcgcagtgggacgtctctacaagggggtaacgcg
accgcgacgagcgggcatacgaagccgagcacgttcactggcacgatgaacacggaggac
tcgcactcgacgttgttcagctccatgtcgaagcatcagcctagcatgacgacggtggac
gcggagcgcacggctccgggcgacgacggacttagttcgcaccggtatcaggtgatacag
cagtcgatgaaggatgagatactatcaagacaaggcacacgtcggagccggaggttcatt
acatcacggcttgcgacgttgggcccggcaaaacggaactctaccacgacaaactttgag
ttttcgtccaacatcagccatgatgaatctagagatgtgtcccaccaggagggcaatgtt
tccacctcttccaacagcaacagtggtgtgcttaacaacaatgggtacaatgttttcctt
gacacggaagaacgcgcaagacacgacgacaaggagagccacagtgcagcccgtcaatct
ggcctaagtgactacggaaacatctcatttggagacttgaacccttaccaatacttgaag
aagcacaacctaccaactagcgagctcccgaacatttcacgaatttacttcgagatgcag
aaaagggaaaataggagggctgcagtacgaaagaatgtactcaatggcagcgggggccag
gtggcacagcttcctacgaataattctgccatagcttccaccgctgttgcattgaaagaa
gccaacggtattgcctctattagctccggtagcaataagctaactccaccacaggctgct
aattcgatgatcaaaagggataggcagccccggaggaagcacagcgatgcctccgtaagc
tctttctctaaattactttcttctcctatatctgcaggggcacccaactatgcagactcc
cagaaacatacacccgtacagaagaattctactccttacgaaccacttttaattaatcag
aataccaagaaaagggaggcactgaatagcctggatgtcaacgcaaaccgccatccttca
ataataaccaagaaacagaaagtggacgagttacatgactacctcaagaaagcccctgcc
gcggcgtccgtgaagaaggtagaaattgtcgaaccagtcagagaccctgtaattacaaca
attcccttaaaacccccatctgcagaggtaccagctaatgtacaccagttaccccaaagg
aagagacaggtgattactgtaaatgggtccgaatatgagaaggtagaactattgggaaga
ggaggctcttcaaaagtttacaaagttcgcaactcaagtaataggatatatgcactcaag
agggtctcctttgatgaatttgatgatgccagtgctgatggattcaaaggcgaaattgaa
cttttgaaaaagttggaaaaccagactcgtgttgtcaaattgatcgatcatgaaatgaac
catggtgtcctatacgtggttatggagtgcggcgatcacgatctctcacaggtgctagcg
cagcggtcaagtatgccgctagacatcgaatttgtgcggtaccatgcgcaggagatgtta
aagtgtgtcaaggttgttcatgatgctggtattgtgcattccgacttgaagcctgccaat
tttgtctttgtcaagggtatcttgaagatcattgactttggcattgccaacgcagttccc
gaccacacagtgaacatttaccgtgatacacagatcggtaccccaaactatatggcacca
gaagcgttagtggcgatgaactacacacaggactcagaccaaattcaacaggaaatgcat
cataatagatggaaggttggcaagccctcagatatctggtcttgtggttgcataatgtac
caaatgatatatgggaagccaccttatgggagctttcaaggccagaataggttactagca
ataatgaacccagaagtgaaaatagtatatcccgaaaagacacctacaggggactttgtc
ccacgtactgcattggatactataaaggcatgtttagaaagaaatccggaaaggcgttgg
accgtggatgagttgttacggggccccttcattaaaccaattaccgttactcatttcttt
attcgcgatttgattaaaaatgcggtaaaatatggttctgatcagaggtatgtttctaag
gaaaaggttgaggacttggcagatgatgtttggcataggttaagtgattttagattgtaa

DBGET integrated database retrieval system