KEGG   Ashbya gossypii (Eremothecium gossypii): AGOS_ADR331CHelp
Entry
AGOS_ADR331C      CDS       T00167                                 

Definition
ADR331Cp
Orthology
K07204  
regulatory associated protein of mTOR
Organism
ago  Ashbya gossypii (Eremothecium gossypii)
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
IV:complement(1285949..1290634)
Genome map
AA seq 1561 aa AA seqDB search
MLYNEHCKPQSKSNRYQGAVSCAGCVRGRGGSIGQETISTGKMPVVYGPQPLNCLNTETR
HGFDEQYSSEQLLESLANGFIFYFDDKRHRSNGNPMSEEEKQQDAHNYYQPILDWKIVKE
RQKTVSAALLLCLNLGVDPPDVIKTHPCARLESWVDPHNFQDSKKAIEQIGKNLQAQYET
LSLRTRYKQSLDPCVEDVKRFCNSLRRASKDERILFHYNGHGVPQPTPSGEIWVFNRGYT
QYIPVSLYDLQTWLGAPCIYVWDCNSAGNIVSNFQKFVQKRIKDDQDGNHDMTAPSSTQA
YIDCVQLAACRSGELLPMNPELPADLFTCCLTDPIEISVKIFLMQSPLKDTKYSILFQND
DSRYGSDNLNRMPNISIPGKLSERRTPLGELNWIFTAITDTIAWTSLPRPLFKKLFRHDL
MVAALFRSFLLAKRIMPWYNCNPVSDPVLPDNIAEHPMWKSWDLAIDEVLTKLVDDMHHN
MDNGSGKLEVQALLQQRQGPVRSETSINGMPESLNSRNPMGNLSTMSLANMNNNKASSSN
PSIQSSSSSALAQGQQQQFTKFFEQHLTAFELWLKYGANTRHPPEQLPIVLQVLLSQVHR
VRTLVLLSRFLDLGPWAVYLSLSIGIFPYVLKLLQSPAQELKPILVFIWARIMSIDYKNT
QTELVKEKGYLYFVKMLVPEWGTQRPASNTGSPLTLTAPVNINVQRASSQVNPGNTTAVL
TSNTTDEQKAMATFVLSSFVNDFPLGQKYCFSQELVQKLCYYVDNSEVPLLRQWCIILIG
QLYLNNPLHKSICLQEMFLARIIRSLKDPIPEIRCAALLSMKYFCSDYDDADLILKLHQE
CQQQIPQLQSRLQQFQTTSQQAQQQQQQLHIQQQQFQVQQQLQQVQSSMVQLQHVDIKQL
KREEIKMISAALVHVNDGSPMVRKELIIFISQVVERYITFFIVIAFNELTEEIITLEFDS
NEANDLKRRTMVGHGSIFNTVWKALLILAADPFTENSILAGDVIDYILIKLKDHPDLGEI
VTEMEKYLIKRTANSHPSGLAMVGMAATKLPTPKRPISLGAYDKSRPTPSAKKTPPSSQR
SYSLSGLLKSLRLTTEEQPAASITNANKKHHLSLLSVPYGVAPIPPTPNYKKRTGPLVMP
LKSMFLEYCREYFQEPQMKKKEADEPGSVEYTARLWRRNRNEQIIQETQAQKQLSLYGDW
SRKVASVDNKTQPKILRLMQFESYLVSSDDRDNVAVYDWEENKHLARFSNGNPFGTKITD
MKFLNEDDVPLLLTGSSDGIVKIYKDFNCLENIELISSWRGLTDLLLTPKSTGLLTEWQQ
SRGSLLATGDVKIIRVWDALTESVEVDVPAKSSSLITSLTSDQLSGNIFVSGFSDGSIRV
YDRRVDPRDSMVRLWKPSGGRPISWITNVHLQRGGYRELVSGTNNGVVELWDIRQDKPVL
TFTDSGQNGGNGYNSSPPKPTTMTSIHVHEHAPVIATGTKHINIWTTSGDSLCTFKNNGS
SHVSSVAGSLATGISVSRSSTSFISSMAFHPHRMMLAAANSHDTNINIYQCRDARNDYSI
Y
NT seq 4686 nt NT seq  +upstreamnt  +downstreamnt
atgttatacaatgaacactgcaaaccacagtcgaagtcaaacaggtaccaaggtgcagta
agctgtgctggttgtgtgcgaggtcgcggaggcagtataggccaagaaacgatttctaca
gggaaaatgccggttgtatatggtccgcagccactaaattgtttgaacactgagaccagg
cacgggtttgacgagcagtactccagtgagcagctgctggagtcgctggcgaacgggttt
atcttctactttgacgacaagcgtcaccgcagcaatgggaacccgatgtcagaggaggag
aagcagcaagacgcgcacaactactatcagccgatcctcgactggaagatcgtgaaggag
cggcaaaagacggtgtctgcagcgttgctgctatgtctgaatttgggtgttgacccgccc
gacgtgatcaagacgcatccgtgtgcgcggctggagtcgtgggtggacccgcacaacttc
caggactcgaagaaagcaatcgagcaaatcggcaagaacctgcaggcgcagtatgagacg
ctgtcgctgcggacgaggtacaagcagagtctcgatccgtgtgtggaggatgtgaagcga
ttctgcaactcgttgcggcgcgcgtccaaggatgagcggattctatttcattacaatggg
catggggtgccacagcccacgccttccggcgagatctgggtattcaatcggggatacacg
cagtacatacctgtctccttatatgacctccagacgtggctgggggcaccatgtatctac
gtgtgggattgcaacagcgcgggtaacattgtgtcgaactttcagaaattcgtccagaag
cgaataaaggacgaccaggacgggaaccacgacatgacggcgccttcttccacccaggca
tacatagactgcgttcagctggctgcttgcaggtctggggagctattgccgatgaaccca
gaattacccgctgatctttttacttgttgcctcacagacccgatagaaatctctgttaaa
atctttctaatgcaatcacccctaaaagacactaaatactcgatactctttcagaatgat
gactctcgctatggttcggataaccttaaccgcatgcctaatatttcgataccggggaaa
ctttctgagagacgaacgccgctgggagagttgaattggattttcacggcgattacagat
accattgcgtggacatccctaccacggcctttgtttaagaaattgttcaggcatgatcta
atggtcgctgccctatttagaagtttcctattggcaaagaggatcatgccctggtataac
tgtaaccccgtttcagaccctgttttgcccgacaatattgcggaacatccaatgtggaaa
tcatgggatttggctattgatgaagttctaacaaagttggtcgatgatatgcatcataat
atggataatggatctggaaaactggaagtgcaagctttattgcagcagaggcagggtcct
gtcagatctgaaactagcattaatggtatgcctgagtcattaaattcgcgcaatccaatg
gggaacctcagcactatgtcattggcgaatatgaataataacaaagcatcttcaagcaat
ccatcaatacaaagttcttcttcttctgcacttgcacagggtcaacagcagcagtttact
aaattcttcgaacaacatctcactgcatttgaactctggctaaaatacggcgcgaataca
agacatcctcctgagcagctacctatagtccttcaggtattgctgtcgcaagtacatcgt
gtgcggactttagtgctgctctctcgattcctcgatttgggaccttgggcagtctactta
tcgttatccattggaatatttccctatgtcctgaaactactccaaagtcctgcacaggag
ctaaagccaattctggtttttatctgggccagaattatgtcaattgattataagaataca
cagacagaactagtaaaggaaaagggctacctttattttgttaagatgttagttccagaa
tggggaacacaacgtccagcgtcaaatacaggaagcccattaacgctcactgcacctgtt
aatataaatgtgcaacgtgcttcttcacaggtaaaccctggtaatactacagcggtacta
actagcaacactactgatgagcaaaaggccatggccactttcgtgttgtcttccttcgtt
aatgattttcccctaggtcaaaagtactgcttcagtcaggaattggtccagaagttgtgt
tattatgttgacaattcagaggttccactattacgccaatggtgcattattttgattggt
cagctttacctgaataatcctcttcacaaaagcatctgtttacaagaaatgtttcttgct
cggataatacgatccttaaaggatcctattcctgaaatccgctgtgcagcattattatcc
atgaagtacttttgctccgattatgacgacgccgatttgattttaaagttgcatcaggaa
tgtcaacaacagattcctcagctacaatcacgattgcagcaattccaaactacaagccaa
caagcgcagcagcaacagcaacagctccatatccagcagcagcagttccaggtgcagcag
caactgcaacaagtacaatcttctatggtgcagctgcagcatgttgatattaagcagctc
aagagagaagagataaaaatgatatctgctgcattggtgcatgtcaatgatggatcacca
atggtccgcaaagaattgattatctttatctctcaggtagttgaaaggtacatcaccttt
tttattgtgattgccttcaacgaattaacagaagaaataataacattagagtttgacagc
aacgaagccaacgacctcaagcgcagaacaatggttggtcatggatccattttcaacact
gtatggaaggctctcttgatccttgcggctgatcctttcactgagaacagtattctggca
ggagatgtcattgattatatcctgatcaagctgaaggatcatcctgatttaggagaaatt
gtgaccgaaatggagaagtacctgataaaaagaactgccaattctcatcctagtgggttg
gccatggtgggaatggccgctacaaagctgcctactccaaaaaggccaattagtctaggc
gcctatgataaaagcagaccgacaccaagcgctaaaaagacgccgccatccagtcagcgc
agttattcgctaagtggtcttttaaagagtttgaggttgacaacagaagagcagcctgct
gcctcaataacaaatgctaacaagaaacatcatctttcgttattaagcgttccttatgga
gtagcacctatacctccaacacctaattataagaagagaactgggccgcttgtgatgccg
ctaaaaagcatgttcttagaatactgccgggaatacttccaggagccacagatgaagaaa
aaagaagcagacgaacccggtagtgttgagtataccgctcgtttatggagaagaaacaga
aacgaacaaataattcaggaaactcaagcccaaaaacagctgtccttatatggtgattgg
tcgagaaaggttgcgagtgttgataataagactcagccaaaaattctacgtttgatgcag
ttcgaaagctatcttgtttcttcagatgatagagataacgtcgctgtctatgactgggaa
gaaaataaacatttggccaggttttcgaatggaaatccgttcgggacgaagataactgat
atgaaatttttaaatgaggatgacgttccgctattattaactggctcatcggatggtatt
gtaaaaatttataaggatttcaactgcctggaaaatattgaactcatttcatcgtggcga
gggttaactgatcttttgctgacgccgaagtctactggtttgctaactgaatggcagcag
agtagaggatctctgcttgctacaggagatgttaaaataattagggtttgggatgctttg
acagaatctgttgaagttgatgtcccggctaagtcttcatcgctcataacatcattaact
tcggaccagttatcaggcaatatatttgtaagcggcttctctgatggttcaattcgggtt
tacgatagacgcgtcgacccaagggattccatggttcgcctatggaagccatctggaggc
cgacctatatcatggataaccaatgtgcatctacaacgtggtggatacagggagcttgtg
agcggaactaacaacggtgtagttgaattgtgggatatcagacaagataagccggtgcta
acatttacagattctggacagaatggggggaacggttacaactctagcccgcctaagcca
acgacaatgacatctatacatgttcatgaacatgctccagtaattgcgacaggaactaag
catatcaatatatggactacatctggtgattcactgtgcacatttaaaaacaacggatca
tcacatgtcagcagtgtggcaggttctttggctacaggcatcagtgtttctcgttcttct
acttcattcatttcctcaatggcattccatcctcataggatgatgttagcggctgccaat
tcacacgatacgaatattaacatatatcaatgccgtgacgcaaggaacgactattccatt
tattaa

DBGET integrated database retrieval system