KEGG   Ashbya gossypii (Eremothecium gossypii): AGOS_ADR399CHelp
Entry
AGOS_ADR399C      CDS       T00167                                 

Definition
ADR399Cp
Orthology
K03253  
translation initiation factor 3 subunit B
Organism
ago  Ashbya gossypii (Eremothecium gossypii)
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:ago00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    AGOS_ADR399C
Translation factors [BR:ago03012]
 Eukaryotic Type
  Initiation factors
   eIF-3
    AGOS_ADR399C
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
IV:complement(1421010..1423220)
Genome map
AA seq 736 aa AA seqDB search
MAAVFDDIRLEDIPVDDVDMQDLEETYAVERSIEFDRYVVVDGAPVAPEAKVGALQKVLT
KLFSQAGSVVDMDVPVEEGRTKGHLFIEFEDAGAARRAIKMFNGKKLDVKHRLWVNGLDD
MERYGRPDFSTEYREPVVPEFEATEYPRSWLQDETGRDQFVLQKGEMTAVFWNRNNLQPE
NVVEPRRNWSNSILNFSPHGTYLFSFHDQGIASWGGPQFKRLRRFAHPDVKAISMSSTEK
YLVTFSSEPLEVSDEPNEACPFGPESRGHQLCIWDVATGVCVKTFALPPQQQLQWPMVKW
SFDDKFCARLGPGAIAVYETEKNFQLLGGKVMKIEDVQDFSFAPKGIKLASNRPNDPPST
VMVYWTPESNNQSCKAVLIELPNRRVLRTINLVQVTDVSFHWQNQAEFLCVQVDRHTKSR
KTIFTNMEICSLTAREFPFEKVEIKDRCMRFAWEPNSDRFVIISRSENVNDNPAIAKNVV
SFYAPEKKVDKKGVIIDKELSIFKKWKLVRAIDGKFSNEITWSPAGRFVCVAAIGKIGSR
NENIDFYDMDYPNTEKIINTATDVNATLRDVAHINYASATDYEWDPSGRYLAFWSSAWKH
KAENGYKVFNLAGAIVREELITDFNNFFWRPRPDSLLSNSEKKKVRKNLKEWSAHFEEQD
AMEADSATRELILKRRNWLDEWSKYREACKQTLSESGLSICDCVELSTKDEDCELVEEIR
ETVVEESTEEVPFFEE
NT seq 2211 nt NT seq  +upstreamnt  +downstreamnt
atggcagcggtattcgacgatataaggcttgaggacatccctgtggatgatgtggatatg
caggaccttgaggagacgtatgctgtagagcggagcatcgaatttgacagatacgtggtt
gtcgacggggcgccggtggcgccggaggcgaaggtgggcgcgctgcagaaggtgctgacg
aagctattttcgcaggcggggtcagtggtggacatggatgtgcctgtcgaagaggggcgg
acgaagggacaccttttcattgagtttgaggacgccggcgctgcgcggcgggcgatcaag
atgttcaacgggaagaagttggacgtcaagcaccgcctgtgggtgaacggactagacgac
atggagcgctacgggcggccggacttttcaacggaataccgggagcctgtggtgccggag
ttcgaggcgacggaatacccacggtcgtggttgcaggacgagacgggtcgggaccagttt
gtgctgcagaagggcgagatgacggctgtattctggaaccggaacaacctgcagccggag
aacgttgtcgaaccgcgccgcaactggtcgaactctatcttgaacttctcgcctcacggt
acgtacctattctcgttccacgaccagggcattgcgtcctggggtgggccgcagttcaag
cgtctccgtcggtttgcgcaccctgatgttaaggcgatctccatgtcctcgaccgagaag
tacctggttaccttttcgtcggaacctctagaagtctcggatgaacctaacgaggcttgt
ccattcgggcccgagtcgcggggccaccagctatgtatatgggatgtggcaacaggtgtc
tgcgtgaagacctttgcgctgccgcctcagcagcagctgcaatggcctatggtcaagtgg
tcctttgacgacaagttctgcgctcgtcttggccctggcgcaattgctgtgtacgagacc
gagaagaacttccagctgttgggcggtaaggtgatgaagatcgaggatgttcaggacttc
tcctttgctcctaagggcatcaagttggcgtcaaacagacccaacgacccaccatctact
gtcatggtatactggactccagagtcgaacaaccagtcgtgtaaagctgtcctgattgag
ctaccgaaccgccgtgttctgcgtaccatcaacttggtgcaggttactgatgtctccttc
cattggcagaaccaggcagagttcctctgtgtacaggtggaccgtcacacgaagtctagg
aagaccatcttcaccaacatggagatttgctctttgactgccagagagtttccatttgag
aaggtggagattaaggaccgctgcatgcgctttgcatgggaacctaatagcgaccgtttc
gtgatcatttcgagatctgagaatgttaacgataaccctgctattgcgaagaacgttgtg
agcttctacgcgcctgagaagaaggtcgacaagaagggtgtcatcattgacaaagagctc
agcatcttcaagaagtggaaacttgtgcgtgccatcgacggcaagttctccaacgaaatt
acctggtcacctgctggacgttttgtatgcgtcgctgctattggtaagattggttcccgt
aacgagaacattgatttctacgatatggactatccaaacactgaaaagatcattaacact
gctactgacgttaacgctaccctgagagacgttgcccacatcaactacgccagtgccact
gattacgaatgggacccaagtggacggtaccttgccttctggtcttccgcgtggaagcac
aaggccgaaaatggatacaaggtattcaacttggccggtgccatcgtgcgtgaggagctc
atcaccgactttaacaacttcttctggagaccaagaccagactctctactatccaactct
gagaagaagaaggtcagaaagaacctcaaggaatggtccgcgcactttgaagagcaggat
gctatggaggcggacagtgctacaagagagttaatcctaaagagacgcaactggttggat
gaatggtccaagtacagagaggcttgcaagcaaaccctatccgaaagtggattgtccatt
tgcgattgtgtcgaactgtcaactaaggatgaggactgtgagcttgtcgaggagattaga
gagactgtggttgaggagtccaccgaggaagtgccatttttcgaggagtaa

DBGET integrated database retrieval system