KEGG   Ashbya gossypii (Eremothecium gossypii): AGOS_AEL002WHelp
Entry
AGOS_AEL002W      CDS       T00167                                 

Definition
AEL002Wp
Orthology
K11252  
histone H2B
Organism
ago  Ashbya gossypii (Eremothecium gossypii)
Brite
Exosome [BR:ago04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   AGOS_AEL002W
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
V:631902..632285
Genome map
AA seq 127 aa AA seqDB search
MAPKAEKKPASKAPAAKKTTASTDASKKRTKTRKETYSSYIYKVLKQTHPDTGISQKSMS
ILNSFVNDIFERIASEASKLAAYNKKSTISAREIQTAVRLILPGELAKHAVSEGTRAVTK
YSSSTQA
NT seq 384 nt NT seq  +upstreamnt  +downstreamnt
atggcaccaaaggctgagaagaaacctgcttccaaggccccagcggcaaagaagaccact
gcttctaccgacgcttctaagaagcggacgaagactagaaaggagacctactcctcttac
atttacaaggttcttaagcagactcacccagatactggtatctcgcagaagtctatgtcc
attttgaactcgtttgtgaacgatatctttgagagaatcgcgtctgaggcatccaagctt
gcggcctacaacaagaagtctacgatctctgctagagaaatccagactgctgtcagattg
atcttgcccggtgagctagccaagcacgccgtgtctgagggtaccagagctgttaccaag
tactcgtcttctacccaagcctga

DBGET integrated database retrieval system