KEGG   Ashbya gossypii (Eremothecium gossypii): AGOS_AEL021CHelp
Entry
AGOS_AEL021C      CDS       T00167                                 

Definition
AEL021Cp
Orthology
K01881  
prolyl-tRNA synthetase [EC:6.1.1.15]
Organism
ago  Ashbya gossypii (Eremothecium gossypii)
Pathway
Aminoacyl-tRNA biosynthesis
Module
Aminoacyl-tRNA biosynthesis, eukaryotes
Brite
KEGG Orthology (KO) [BR:ago00001]
 Genetic Information Processing
  Translation
   00970 Aminoacyl-tRNA biosynthesis
    AGOS_AEL021C
Enzymes [BR:ago01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.15  proline---tRNA ligase
     AGOS_AEL021C
Amino acid related enzymes [BR:ago01007]
 Aminoacyl-tRNA synthetase
  Class II (G/C)
   AGOS_AEL021C
Transfer RNA biogenesis [BR:ago03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    AGOS_AEL021C
 Prokaryotic Type
    AGOS_AEL021C
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
V:complement(595323..597335)
Genome map
AA seq 670 aa AA seqDB search
MPLNEQFALLALDAECAAPVKQLVFKPKVAKSAIAVPVVVVALQSTTTPVGVVAHASGSK
DPRLARDELFQSHFGVETAKAFDLSHLEQAQHGFQLLVDRELAALADEAAVGLSGVAVEK
GALMAYLQKHGAVEVDFAQEVQAAAPKAKKGAAVVKESAALADAKLIGITVDKALDFPGW
YQQVLVKGDLLDYYDISGCYILKPASYCIWERIQEWFNGKIRSMGVQNVCFPMFISSRAL
EKEKDHIEGFAPEVAWVTKAGSSDLEEPIAIRPTSETAMYPFFAKWVQSYRDLPLKYNQW
TSVVRWEFKHPQPFLRTREFLWQEGHTAHLTKEEATDEVMQILDHYEQVYVELLAVPVVK
GTKTENEKFAGADFTTSVEGYIPQTGRGIQGATSHHLGQNFSKMFNICVENPLGPQHPKV
HAYQNSWGLSTRSIGVMVMTHSDNKGLVIPPRVAQHQVVILPVGITAKTKEDVRSKIHDS
ARAIENRLHKAGIRVLGDYADNYTPGWKFAQYELKGVPLRLEFGPKDMEKAQVTAVRRND
GAKISVPLADLEERIPQILDEMHQLLYQKAKKSFDDHLITVTEWKDFVPTLNKKNIILSP
WCGVPECETDIKASSAKKDDGDEYEVDEKAPSMGAKSLCVPFEQPVLAPGQKCIKCDKPA
VNYCMFGRSY
NT seq 2013 nt NT seq  +upstreamnt  +downstreamnt
atgcctcttaatgaacagtttgccttgttggccctcgatgcagagtgtgccgccccagtg
aagcagctggtgttcaagccgaaggtagcaaaatcggcgatcgccgtgccagtagtggtt
gtggcgctacagagcacgacgaccccagttggtgtcgtagcgcacgccagcggtagcaag
gacccgcgcctggcgcgggacgagctgttccagagtcattttggtgtggagacagcgaag
gcatttgatttgtcgcacctggagcaggcgcagcacgggttccagttgttggtggaccgg
gagctggcagcgctcgcggacgaggccgcggtgggcctgagcggggtggcggtggagaag
ggcgcgttgatggcgtacttgcaaaagcacggcgcggtggaggtggactttgcgcaggag
gtgcaggcggcggcgcccaaggcgaagaagggcgcggcggttgtgaaggagtcggctgcg
ctggcggacgcgaagctgatcgggatcaccgtggacaaggcgctggacttcccgggctgg
taccagcaggtgctggtcaagggcgacctgctggactactacgacatctccgggtgctac
attctgaagccggcgtcgtactgcatctgggagcgcatccaggagtggttcaacggcaag
atccggagcatgggcgtgcagaacgtgtgcttcccgatgtttatctcgtcccgggcgctg
gagaaggagaaggaccacatcgagggctttgcgccggaggttgcgtgggtgacgaaggcg
ggctcttccgacttggaggagcccattgcgatccggccgacctccgagaccgcgatgtac
ccgttcttcgcgaagtgggtgcagtcgtacagagacctgccgctcaagtacaaccagtgg
acctctgtagtgagatgggagttcaagcatccgcagccgttcttgcggacgcgggagttc
ctgtggcaagagggccacaccgcgcatttgacgaaggaggaggccaccgacgaggtgatg
cagatcctggaccactatgagcaggtgtatgttgagttgctggctgttccagttgtgaag
ggtaccaagacggaaaacgagaagtttgccggtgcggacttcacgacgtcggttgagggt
tacattccgcagaccggccgtggtatccagggcgctacctcgcaccacctgggccagaac
ttctccaagatgtttaacatttgtgtcgagaaccctcttggcccccagcatccaaaggtg
catgcctaccagaactcctgggggctgtccacgaggtctattggtgtgatggtgatgacc
cactctgacaacaagggtctggttatccctcctagagttgcacagcaccaggtagtgatt
ttgccagttggaattaccgcgaagacgaaggaggatgttagatccaagatccacgactcc
gccagggccattgaaaacagattgcataaggccggtatcagagtcctcggggattatgct
gacaactacaccccgggctggaagtttgcccagtacgaactgaagggtgttcctttgaga
ctggaatttggtcctaaggacatggagaaggcgcaggtcacggccgtgcggagaaacgac
ggcgcgaagatcagcgttccgctagccgacctggaggagagaataccgcaaatcctagac
gaaatgcaccagttgctataccaaaaggctaaaaaatcgttcgacgaccacttgatcact
gtcacggaatggaaggattttgttccaacgttgaacaagaagaacattattctatcgcca
tggtgcggcgtccccgagtgtgaaaccgacatcaaggcatcttccgcgaagaaggacgat
ggtgacgaatatgaagtagacgaaaaagccccaagtatgggcgccaagtctctgtgtgtt
cctttcgaacagcccgttctagcaccgggccagaagtgtatcaaatgtgataaacctgcc
gtaaactactgtatgtttggccgctcgtactaa

DBGET integrated database retrieval system