KEGG   Ashbya gossypii (Eremothecium gossypii): AGOS_AEL021CHelp
Entry
AGOS_AEL021C      CDS       T00167                                 

Definition
AEL021Cp
Orthology
K01881  
prolyl-tRNA synthetase [EC:6.1.1.15]
Organism
ago  Ashbya gossypii (Eremothecium gossypii)
Pathway
Aminoacyl-tRNA biosynthesis
Module
Aminoacyl-tRNA biosynthesis, eukaryotes
Class
Genetic Information Processing; Translation; Aminoacyl-tRNA biosynthesis [PATH:ago00970]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
V:complement(595323..597335)
Genome map
AA seq 670 aa AA seqDB search
MPLNEQFALLALDAECAAPVKQLVFKPKVAKSAIAVPVVVVALQSTTTPVGVVAHASGSK
DPRLARDELFQSHFGVETAKAFDLSHLEQAQHGFQLLVDRELAALADEAAVGLSGVAVEK
GALMAYLQKHGAVEVDFAQEVQAAAPKAKKGAAVVKESAALADAKLIGITVDKALDFPGW
YQQVLVKGDLLDYYDISGCYILKPASYCIWERIQEWFNGKIRSMGVQNVCFPMFISSRAL
EKEKDHIEGFAPEVAWVTKAGSSDLEEPIAIRPTSETAMYPFFAKWVQSYRDLPLKYNQW
TSVVRWEFKHPQPFLRTREFLWQEGHTAHLTKEEATDEVMQILDHYEQVYVELLAVPVVK
GTKTENEKFAGADFTTSVEGYIPQTGRGIQGATSHHLGQNFSKMFNICVENPLGPQHPKV
HAYQNSWGLSTRSIGVMVMTHSDNKGLVIPPRVAQHQVVILPVGITAKTKEDVRSKIHDS
ARAIENRLHKAGIRVLGDYADNYTPGWKFAQYELKGVPLRLEFGPKDMEKAQVTAVRRND
GAKISVPLADLEERIPQILDEMHQLLYQKAKKSFDDHLITVTEWKDFVPTLNKKNIILSP
WCGVPECETDIKASSAKKDDGDEYEVDEKAPSMGAKSLCVPFEQPVLAPGQKCIKCDKPA
VNYCMFGRSY
NT seq 2013 nt NT seq  +upstreamnt  +downstreamnt
atgcctcttaatgaacagtttgccttgttggccctcgatgcagagtgtgccgccccagtg
aagcagctggtgttcaagccgaaggtagcaaaatcggcgatcgccgtgccagtagtggtt
gtggcgctacagagcacgacgaccccagttggtgtcgtagcgcacgccagcggtagcaag
gacccgcgcctggcgcgggacgagctgttccagagtcattttggtgtggagacagcgaag
gcatttgatttgtcgcacctggagcaggcgcagcacgggttccagttgttggtggaccgg
gagctggcagcgctcgcggacgaggccgcggtgggcctgagcggggtggcggtggagaag
ggcgcgttgatggcgtacttgcaaaagcacggcgcggtggaggtggactttgcgcaggag
gtgcaggcggcggcgcccaaggcgaagaagggcgcggcggttgtgaaggagtcggctgcg
ctggcggacgcgaagctgatcgggatcaccgtggacaaggcgctggacttcccgggctgg
taccagcaggtgctggtcaagggcgacctgctggactactacgacatctccgggtgctac
attctgaagccggcgtcgtactgcatctgggagcgcatccaggagtggttcaacggcaag
atccggagcatgggcgtgcagaacgtgtgcttcccgatgtttatctcgtcccgggcgctg
gagaaggagaaggaccacatcgagggctttgcgccggaggttgcgtgggtgacgaaggcg
ggctcttccgacttggaggagcccattgcgatccggccgacctccgagaccgcgatgtac
ccgttcttcgcgaagtgggtgcagtcgtacagagacctgccgctcaagtacaaccagtgg
acctctgtagtgagatgggagttcaagcatccgcagccgttcttgcggacgcgggagttc
ctgtggcaagagggccacaccgcgcatttgacgaaggaggaggccaccgacgaggtgatg
cagatcctggaccactatgagcaggtgtatgttgagttgctggctgttccagttgtgaag
ggtaccaagacggaaaacgagaagtttgccggtgcggacttcacgacgtcggttgagggt
tacattccgcagaccggccgtggtatccagggcgctacctcgcaccacctgggccagaac
ttctccaagatgtttaacatttgtgtcgagaaccctcttggcccccagcatccaaaggtg
catgcctaccagaactcctgggggctgtccacgaggtctattggtgtgatggtgatgacc
cactctgacaacaagggtctggttatccctcctagagttgcacagcaccaggtagtgatt
ttgccagttggaattaccgcgaagacgaaggaggatgttagatccaagatccacgactcc
gccagggccattgaaaacagattgcataaggccggtatcagagtcctcggggattatgct
gacaactacaccccgggctggaagtttgcccagtacgaactgaagggtgttcctttgaga
ctggaatttggtcctaaggacatggagaaggcgcaggtcacggccgtgcggagaaacgac
ggcgcgaagatcagcgttccgctagccgacctggaggagagaataccgcaaatcctagac
gaaatgcaccagttgctataccaaaaggctaaaaaatcgttcgacgaccacttgatcact
gtcacggaatggaaggattttgttccaacgttgaacaagaagaacattattctatcgcca
tggtgcggcgtccccgagtgtgaaaccgacatcaaggcatcttccgcgaagaaggacgat
ggtgacgaatatgaagtagacgaaaaagccccaagtatgggcgccaagtctctgtgtgtt
cctttcgaacagcccgttctagcaccgggccagaagtgtatcaaatgtgataaacctgcc
gtaaactactgtatgtttggccgctcgtactaa

DBGET integrated database retrieval system