KEGG   Ashbya gossypii (Eremothecium gossypii): AGOS_AEL029WHelp
Entry
AGOS_AEL029W      CDS       T00167                                 

Definition
AEL029Wp
Orthology
K11843  
ubiquitin carboxyl-terminal hydrolase 14 [EC:3.4.19.12]
Organism
ago  Ashbya gossypii (Eremothecium gossypii)
Brite
Enzymes [BR:ago01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     AGOS_AEL029W
Peptidases [BR:ago01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   AGOS_AEL029W
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
V:join(579017..579032,579138..580597)
Genome map
AA seq 491 aa AA seqDB search
MGDFEFSIKHAGKVLPIKLPAGSTGADLRKAVEELVQIPADRQKYMVKGGLGDETAVADV
VKPGSSVLLLGTPDKDMVVKPRTAEKFIEDLGADAQSGQLSRVPMGIVNMGNTCYMNATL
QGLYGIVPLREQILAFDDKKATAEGMDLYHVQLIREIQATFRKLRDKKGEAITPMLLLEI
LRRVFPQFSEMDRQGGFYKQQDAEELFTQLFHTMQTVFGEELIDRFKIGFKTTIKDTMNE
GDVTEKTEDDLKLRCHITGATNFMKAGIKESLKETIEKRSDVTGASSTYSVEKKITKLPE
YLTVQYVRFFWKKSTGKKSKILRKVQFPFQLDVADLLTPEYAQTKIQVREAFREVDKERA
ESIRERKRSKFNPAPAEGGSTPAEAAEIARSLEESTREKWARAFAAKTPADLGRGENPSC
VYDLIGVITHQGANSESGHYQAFMRDEFDDDKWYKFNDDKVTAIEKEKIESLAGGGESDS
ALILIYKGFGL
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atgggtgattttgaatttagcatcaagcatgcgggtaaagtacttccgatcaagctgcca
gcggggtcgaccggagcagacctgcgcaaggcggtggaggagctggtgcagatccctgca
gatcggcagaaatacatggtgaaggggggcctgggcgacgagacggccgttgcagatgtg
gtgaagccgggctccagcgtgctgctgctcgggacgccagacaaggacatggttgtgaag
ccgaggaccgcggagaagttcatcgaggatctgggcgcggacgcgcagagcgggcagctg
agcagggtgccgatgggcatcgtcaacatgggcaacacatgctacatgaacgccacgctg
cagggcctatacgggatcgtcccgctccgcgagcagatacttgcatttgacgacaagaag
gcgacggccgagggcatggacctgtatcacgtccagttgatacgggagatccaggcgact
ttcagaaagctgcgcgacaagaagggcgaggccatcaccccgatgttgctactggagata
ctgcgccgggtgtttccgcagttctcggagatggacaggcaaggcgggttctacaagcag
caggacgccgaggagctgttcacacagctgttccataccatgcagacggtctttggcgag
gagctcatcgacagattcaaaattggttttaagaccaccatcaaagatacaatgaacgaa
ggcgacgtgaccgagaagaccgaggacgacctgaagctgcggtgccacatcacgggcgcc
accaacttcatgaaggcggggatcaaggagtccctgaaggagacaatcgagaagcgctcc
gacgtcacgggcgcgtcctccacgtacagcgtggagaagaagatcacgaagctacccgag
tacctcacggtgcagtacgtgaggttcttctggaagaagtcgaccggcaagaagtccaaa
atcctgcgcaaggtgcagttccccttccagttggatgtggcagacctcttgacaccggag
tacgcccaaacgaagatccaggtgcgcgaggcgttccgcgaggtcgacaaggaaagggca
gagtcgatccgcgaacgcaagcggtcgaagttcaacccggcccccgccgagggtggctcg
acccccgctgaggcagcagagatcgcgcgctcgctggaggaaagcacgcgcgagaagtgg
gcccgggcgttcgcagcgaagacgccggcggacctgggccgcggcgagaacccctcctgc
gtctacgacctgatcggcgtgatcacccaccagggcgccaactccgagtcaggccactac
caggccttcatgagagacgaattcgacgacgacaagtggtataagtttaacgatgacaag
gtcactgccatcgaaaaagagaaaatagagtccctggccggcggcggcgaaagcgatagc
gcgctgatcctcatctacaaaggctttggcttgtga

DBGET integrated database retrieval system