KEGG   Ashbya gossypii (Eremothecium gossypii): AGOS_AEL044WHelp
Entry
AGOS_AEL044W      CDS       T00167                                 

Definition
AEL044Wp
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
ago  Ashbya gossypii (Eremothecium gossypii)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:ago00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
V:549753..551864
Genome map
AA seq 703 aa AA seqDB search
MAGVPDNVKGVVELDPWLAPYGDILSARRFLADKWRHDIEHAVPGGRRSLVEFARDAYKS
YGLHADAQSKSITYREWAPNATRAFLVGDFNGWDETSHELQNKDEFGVFTGVFGPGADGD
FMIPHDSRVKVVFELADGSRIHRLPAWIKRATQPSKETAKEWGPSYEARFWNPASPYKFK
HERPRLDPNVESLRIYEAHVGISTPEPRVGSYSEFTKDVLPRIRDLGYNAIQLMAIMEHA
YYASFGYQVTNFFAVSSRYGTPEELKELIDTAHGMGIQVLLDVVHSHASKNVSDGLNMFD
GTDYQYFHSISSGRGEHPLWDSRLFNYGSFEVQRFLLANLAFYIDVYQFDGFRFDGVTSM
LYHHHGVGERGAFSGDYNEYLSDHSGVDHEALAYLMLANDLIHDMLPANGVTVAEDVSGY
PTLCLPRSVGGCGFDYRLAMALPDMWIKLLKESKDEDWSMGHIVYTLVNRRYKEKVVAYA
ESHDQALVGDKTLAFWMMDAAMYTDMTVLKELTPVVDRGIALHKLIRLITHSLGGESYLN
FEGNEFGHPEWLDFPNANNGDSYQYARRQFNLVDDGLLRYKHLYAFDKAMQEAEGKHKWL
NTPQAYVSLKHETDKVISFERNGLVFIFNFHPTQSFTDYRIGVDEAGAYRIILNSDREEF
GGHRRIEEENSVFHTTDLEWNGRRNFIQVYLPSRTALVLARNP
NT seq 2112 nt NT seq  +upstreamnt  +downstreamnt
atggctggtgtacctgataacgtcaagggcgtggttgagctggacccctggttagctcct
tacggggacatcctctctgcgagacggttccttgccgacaagtggaggcacgatatcgaa
catgcggtgcccggcgggcggcgcagtctagttgagtttgcgcgcgacgcatacaagagc
tacgggctgcacgcggacgcgcagagcaaaagcataacgtacagggagtgggcgcccaat
gcaacccgggcgtttctagtcggcgacttcaacgggtgggatgagacctcgcacgagctc
cagaacaaggacgagttcggggtgttcacgggtgtgttcggacctggggcggacggcgat
ttcatgattccgcatgactcacgcgtgaaggtggtgttcgagcttgccgacgggagccgg
atacaccggttgccagcgtggatcaaaagggcgacgcagcccagcaaggagaccgcgaag
gagtgggggccgtcgtacgaggcgcggttctggaaccctgccagcccctacaaattcaag
cacgaaaggccgcgcctggacccgaacgtggagtctctgagaatatacgaggcacacgtg
ggcatctcgacgccggagccgcgggttggcagctacagcgagttcaccaaggatgtgctg
ccgcgcatcagggatctcggatacaacgcgatacagctgatggcgatcatggagcacgcg
tactacgcgtcgttcggctaccaggtcacgaacttctttgctgtttcttcgcggtacggg
acgccagaggagctcaaggagctcatcgacactgcccacggaatgggcatccaggtgctg
cttgacgttgtgcactcccacgcctcgaagaacgtctccgacggactgaacatgttcgat
ggcaccgactaccagtacttccactccatcagctccggacgcggcgagcacccgctgtgg
gactcgaggctgttcaactacggcagctttgaggtgcaacggtttttgctggcgaacctt
gcattttacatcgatgtctatcagttcgacgggttccgcttcgatggcgtgacctcgatg
ctttatcatcaccacggcgtcggagagcgcggcgcgttcagtggtgactataacgagtat
ctctccgaccattcgggcgttgaccacgaggcgctggcgtacctcatgctggccaatgac
ttgatccatgacatgctgcccgccaacggcgtgaccgttgctgaagacgtgtccggttat
ccaaccctttgcttgccccggtctgtgggtggctgtggatttgattaccgcctcgccatg
gcgctgccagatatgtggattaagctgctaaaggagagcaaggacgaggactggagcatg
ggccacattgtctacacgcttgtcaacaggcgctacaaagaaaaggtcgtcgcgtatgca
gagtcgcacgaccaggcgctcgtgggcgataaaacgctcgcgttctggatgatggacgcc
gcgatgtacaccgacatgacggtgctgaaggagctcacgccggtggtcgaccggggcatc
gcgctgcacaagctgatccgcctgatcacgcactcgctcggcggcgaatcctacctgaac
tttgaagggaatgagtttggtcatcccgagtggctggacttcccgaacgccaacaatggc
gacagctaccagtacgcccgccgccagttcaatctggtggacgacggcctcctccgctat
aagcacctctatgccttcgataaggccatgcaggaggcagagggcaagcacaagtggctg
aatactccccaggcctacgtctcgctgaaacatgagacagacaaggtcatctccttcgag
cgcaacggcctcgtgttcatcttcaacttccatccgacccagtccttcacggactaccgc
atcggagttgacgaggcgggcgcgtaccgtataatcctcaactcggacagagaggagttc
ggcgggcaccgccgcatagaggaggaaaactccgtattccacaccacagacctcgagtgg
aacggcagaagaaacttcatccaagtctatctgccctcgagaaccgcgctggttctggcg
cgcaacccctga

DBGET integrated database retrieval system