KEGG   Ashbya gossypii (Eremothecium gossypii): AGOS_AEL088CHelp
Entry
AGOS_AEL088C      CDS       T00167                                 

Definition
AEL088Cp
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
ago  Ashbya gossypii (Eremothecium gossypii)
Pathway
Sulfur metabolism
Metabolic pathways
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:ago00920]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
V:complement(460837..461904)
Genome map
AA seq 355 aa AA seqDB search
MSYEKELRVAVQAVRKASLLTKRIQSQITSNKGLSSFTKDDNSPVTIGDFGAQAVIINAI
KVHFPDDKVVAEETSEGYSDELMEQVLSEIRGADSEFGAVLGDVATEVPLTNSRFPLTSG
VQVRAAIDAGNHTGGREGRFWCLDPIDGTKGFLRGAQYAVCLALVVEGVVRLGVIGCPNL
QLAPFGLQDPAPAPLGYLFKAVDGSGSFYGSTTSDVWSPAAVRRLAHSSEMVALEGYEKT
HSAHDAQAVIKESLGMTRSHQLDSQAKYCLLAAGLGDLYLRLPLSLAYQEKIWDHAAGNV
IVREAGGVHTDAVLGQPLDFGAGRTLLTKGVIASCGPASVHEHVVSISSDVIKNR
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgtcatacgaaaaagaattgcgggtagccgtgcaagcagtgcgtaaggcatcgctatta
actaagagaatccaatctcagatcacttccaacaaaggcctctcctcatttactaaggat
gacaactcgccggtaacaatcggcgattttggcgcgcaggccgtgatcattaacgctatc
aaggtacactttccggatgacaaggtggtggccgaagaaaccagcgaaggttacagcgac
gagctcatggagcaggtgctgagcgaaattcgcggtgccgacagcgagtttggcgcggtt
ctaggcgatgttgcaacagaggtgcccctcaccaattcgcgattcccgctcacgagcggg
gttcaagtgcgtgctgctatcgacgccgggaatcacactggtggacgcgagggccgcttc
tggtgcctggacccgatagatggcaccaaaggattcctcaggggcgcacagtatgccgtg
tgcctggcgctcgtggtcgaaggtgtcgtgcgccttggcgtcatcggctgccctaacctg
cagctggcgcccttcggcctccaggacccggctcccgcgccgctgggctacttattcaag
gctgtcgacggctccgggtctttctacggctccactacctccgacgtctggagcccagcc
gctgtgcgccgcctcgcgcattcttcggaaatggtcgctctcgagggctacgaaaaaaca
cactcggcgcacgacgcccaggcagtcatcaaagaatctcttggcatgacgcggtcacac
cagcttgactcccaggccaagtactgtctgctcgccgccggcttgggcgacctttacctg
cgccttcctctcagcctcgcctaccaggaaaagatctgggaccacgcggcagggaatgta
attgtgcgcgaggctggcggcgtgcatactgacgcagtcttaggccagccactcgacttc
ggcgccggcagaactcttttaactaaaggcgtcatcgccagctgcggtccagcgtctgtc
cacgagcacgtggtttcaatatcgtcagacgtgattaaaaaccgttga

DBGET integrated database retrieval system