KEGG   Ashbya gossypii (Eremothecium gossypii): AGOS_AEL276CHelp
Entry
AGOS_AEL276C      CDS       T00167                                 

Definition
AEL276Cp
Orthology
K01196  
glycogen debranching enzyme [EC:2.4.1.25 3.2.1.33]
Organism
ago  Ashbya gossypii (Eremothecium gossypii)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ago00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    AGOS_AEL276C
Enzymes [BR:ago01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     AGOS_AEL276C
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.33  amylo-alpha-1,6-glucosidase
     AGOS_AEL276C
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
V:complement(120334..124890)
Genome map
AA seq 1518 aa AA seqDB search
MAVPKASSCMTSEASFRSQQRAQTAMKTVLLRLDDNGEPVRGEVGKGVLTLPCLPVGRDA
GEDSGLRVRLVVAAGSPVTRDGLVWTNCPPERNTKFQRNKFYKHLLSAGFLEDSCVDVDV
YVPGSYCYYVSFRNEREQLETTRRFYFVVPPVLSLGEQLVPMNTLAVQSVVSKWMGTDWE
PIFRKISGKGYNMVHFTPLQARGESNSPYSIYDQLQFDLAHFHSAEDVSRMVGKLHRDYR
MLAMTDVVFNHTANNSAWLLEHPEAGYNGETAPHLLAAIELDRQLLQFSRDLAALGYPTN
LRTVDDLLRVLDGIKTHVLSELKLWEYYVVDVQSTLTELAHMWEKVDAIDEGVPNQYRED
LHWIATYTCQRAAQPGFGSLAGRFSNKIDADKFISILKGLYGASWRPGHLDSAHKILDEI
NLPLYKEYDADIGEILEQLYNRIRYLRLDSNGPQLGPITEQDPLTEPYFTWVEAKDGKQY
ALANNGWIWNGNPLVDFASEKSKSYLRREVIVWSDCVKLRYGASPHDSPYLWSRMTQYIE
MNAKIFDGFRIDNCHSTPLHVGEYFLDLAREINPNLYVAAELFSGDEALDCLYVERLAIS
SLIREAMQAWSEEELSRIVHRHGGRPIGSYKYMPLTYFSSPKEGENYNGVTKSIDNEYTL
PVVCTATAPHALFMDCTHDNETPYQKRTLQDTLPTAALVAFCSSAIGSVYGYDEIFPRLL
DVVTEDRTYSVVEGDGISMVKAQLSNIRKLVASSMGDIEDSEMHVHHDGQYITFHRTNSK
TVEGWFLVARSKFREGDPEQRLPDITLAGVKCELEFSYALEQTGDVPDDNGKVILGIPTR
LSELSGFEVKYEPDSNVSTISMPGYFPQGSIAVFKTSMVGMDDELEGFISAGITRATQNL
NLYSLNSVLYRCKAEEMDRTGNKNSVYNIPGYGDLVYCGLQGWVSVLKDIIPENNLAHPL
SEHLRNGTWAPDYIVNSLDWYNNEPGVKDIQNWFRTKFERIKSLPYYLIPRYFALVVGIA
YVACHRKAMSLMTNTIGTSTMFIQQLAMVSVQMVSNISSASLLPDRTVPSMAAGLPHFST
HYMRCWGRDVFISLRGLLLVTGRFEDAKMHILAFAKTLKHGLIPNLLAAGKDPRYNARDA
AWFFIQSIQDYISIVPNGEQILEERVTRRFPLDDTYIPYDDPAAFSYSSSIRDIIFEILS
RHALGIKYREANAGPRLDSVMSDRGFNVEIHVDWSTGLIHGGSQYNCGTWMDKMGESKLA
GTYGVPGTPRDGAAVEINGLLKSALRFVLELHSRGLFPHTAVPRADGSLISFVAWNDLLQ
ANFERKFYVPEDPSEDSSFDIDPSLVNRRGIYKDLCHSGKPYEDYQLRPNFTIAMTVAPE
LFSPQRAQRALAIADRVIRGPVGMRTLDPSDYNYYPDYNNGQDSTNPHTARGRNYHQGPE
WIWCYGYFLRAYARFSAAPASALHQRLQQRLRNHRTWLVTSPWAGLTELTNRDGAYCHDS
SPTQAWSASCLLDLLYDV
NT seq 4557 nt NT seq  +upstreamnt  +downstreamnt
atggcagttcccaaggctagcagctgcatgacaagcgaagcttcctttagatcgcagcaa
agggcgcaaacagcgatgaaaaccgtgctgttgagattagacgacaacggggagccggtg
agaggagaggttggaaagggtgtgctcacgttgccatgtttacctgttggccgagacgct
ggggaggacagcgggctgcgggtgcggttggtggtagccgccggatcgcctgtgacacgg
gacgggctagtgtggaccaactgcccgccggaaaggaatacgaagttccagcggaacaag
ttttacaagcatctgctgagcgcaggtttcttggaggacagctgcgtggatgtggatgtg
tacgtaccgggctcgtattgctactacgtgtcgttccgcaacgagcgggagcagctggag
accacgcggcggttctactttgtggtgccgccggtgctgagcctaggagagcagcttgtg
ccgatgaacacgctggcggtgcagtcggtagtgtcgaagtggatgggtacggattgggag
ccgatattccgcaagatctccggcaagggctacaacatggtgcattttaccccactgcag
gcccgtggcgagtcgaactctccgtactcgatatacgaccagctgcagtttgacctggcc
cacttccacagcgccgaggatgtgtctcggatggttggtaagctacacagggattatcgc
atgctggccatgaccgatgtggtgtttaaccacacggcaaacaactctgcatggcttctt
gagcacccggaagctggctacaatggcgaaacggccccccatttgcttgctgctatcgag
ttagacaggcagttgctgcagttcagtagagatctggctgccctcggatacccgaccaat
ttgcgtactgtagacgacctcttgcgtgtgctggacggcatcaaaactcacgtcctgtca
gagctgaagctgtgggagtactatgtcgttgatgtgcaatcgacgctcacggagctggcc
catatgtgggaaaaggtggatgccattgacgagggcgtccccaaccagtacagggaagac
ctgcactggatagcgacctacacctgccagcgtgcagcgcaacctggatttggatctctt
gcaggcaggttttccaacaaaattgatgctgataagtttatcagtattttgaagggcctc
tacggggctagctggcgcccaggccacttggattccgcacacaagatattggacgaaatt
aacctgcccctctacaaggagtatgatgctgatattggcgaaatcctagaacaattgtac
aataggattcgctacctgcgtttagattcgaacgggccacaattgggtccgattactgag
caagatccacttaccgaaccgtacttcacgtgggtagaagcaaaggacggcaagcaatac
gcgctggcaaacaacggatggatctggaacggtaatccattggttgactttgcctctgaa
aaaagtaagtcatacctcagaagagaggtcatagtttggagtgactgtgtcaagttacga
tatggtgcctccccgcacgactcgccctatttgtggtctcgaatgacgcaatatattgag
atgaatgcaaaaatatttgacggtttcaggattgataattgtcattctacgccattacat
gtgggcgagtatttccttgacctagcgagggagattaatccaaatctgtatgtggcggct
gagttattctctggtgatgaggctttggactgtctatacgtcgaaaggctggccatttct
tcgttaattcgcgaggcaatgcaggcttggtcggaggaggaattatctcgcattgtgcat
aggcatggcggaagaccaattggatcttacaagtacatgcctctgacctacttcagctct
ccaaaggaaggagaaaattacaacggcgttaccaaaagtatcgacaacgagtacacgctc
ccagttgtctgcacagctaccgcaccacatgctttattcatggattgtactcatgacaac
gaaaccccgtaccagaaaaggactttgcaagataccctaccaacagcagcgttggttgca
ttctgttcttctgcgatcgggtcagtatatggctatgatgaaatatttccccgtctacta
gatgttgtgacagaagatcggacctattcggtagtggaaggcgacggtatctcaatggta
aaggcacagctatccaacataagaaaattagtcgccagctctatgggcgatattgaagac
tctgagatgcatgtgcatcatgatggccagtatatcacattccaccgaacgaactccaag
accgttgaaggttggtttttggttgctcggagtaagtttcgcgagggcgatcccgaacaa
cggctgcctgatatcactctcgctggtgtgaagtgcgaactggaatttagttacgcattg
gaacagacgggcgatgtccccgatgacaacggaaaagttattctcggtattcctacccgc
ttgagtgaattatctggatttgaagtcaagtacgagccggactccaacgtcagtactata
tctatgcctggttatttcccccaaggttcaatagcagtattcaaaacgagtatggtcggt
atggatgacgaattggaaggattcatctctgcaggaatcacaagggcgacgcaaaattta
aacttatactccttgaacagcgtgctctatagatgcaaagctgaagaaatggaccgtact
ggaaacaaaaatagtgtctataacattccaggatatggcgaccttgtctactgtgggtta
caaggctgggtcagcgttctaaaggacatcatacctgaaaataacttagctcatccattg
agcgaacatctgcgcaatggcacatgggcgcctgattatattgttaacagtttggattgg
tacaataatgagcctggtgttaaagatattcaaaactggttccggaccaaatttgaacgc
ataaagagcctcccctattacctcattcccagatattttgcactggtggttgggattgcc
tatgtcgcctgccataggaaggctatgtcgttgatgaccaatactataggcacatccacc
atgtttattcaacaattggccatggtctctgtgcagatggtttcgaacattagctccgcg
tctttacttcctgaccgcactgttccatcgatggcagcaggcttgccacacttcagcacg
cactacatgcgatgctgggggcgtgacgtcttcatctcccttcgcggccttctgcttgtt
accggaagattcgaagatgcgaaaatgcacattttagcttttgccaagacgctaaaacat
ggattgattccgaatctcctcgcggcaggcaaggatccaagatacaatgctcgagatgcc
gcatggtttttcatacagtctatccaggactatatttccattgtccccaacggagagcag
atcctagaagagcgtgtcacgcgcaggttccctcttgacgacacatacataccctacgat
gacccagcggcgttcagctactccagttctatcagggatatcatttttgagatcttatcc
cggcatgcgctcgggatcaagtaccgggaggctaacgcgggcccgcgcctcgactcggtg
atgtcggaccgaggctttaacgtagaaatccacgtcgactggagcacggggctcatccat
ggcggctcccagtacaactgcggcacgtggatggataagatgggagagagcaagctcgcc
ggcacctacggtgtccccggcacgcctcgcgacggtgctgcggtcgaaatcaacggtctg
ctcaagagcgcgttgcgctttgtgctggagctccattcccgtggccttttcccccacacc
gcagtccctcgtgcggacggcagcctcatctcgttcgtcgcgtggaatgaccttctacag
gccaacttcgagcgtaagttttatgtcccagaggacccctcggaggactcctcctttgac
atcgacccctccctggtcaaccgccgcggcatctacaaggatctctgccactccggtaag
ccttacgaggactatcagctccgccccaacttcaccatagccatgacagttgccccagag
ctcttctccccgcagcgcgcccaacgcgccctcgccatcgctgatcgcgttatccgcggc
cccgtcgggatgcgcaccctcgacccctcggactacaactactaccccgactacaacaat
ggtcaggactccaccaatcctcacaccgctcgtgggcgcaactaccatcagggtcctgag
tggatctggtgttacggctacttcctccgcgcctacgcccgcttctctgctgcgcccgcc
tcggcgctgcaccagaggctgcagcagaggctgcggaaccatcgcacctggctggtcacc
agcccgtgggccggtctcacggaactaaccaaccgtgacggggcctactgccacgactcg
agtccgacccaggcctggagcgcgagctgcttattagacctgttatacgacgtctga

DBGET integrated database retrieval system