KEGG   Ashbya gossypii (Eremothecium gossypii): AGOS_AER096CHelp
Entry
AGOS_AER096C      CDS       T00167                                 

Definition
AER096Cp
Orthology
K06268  
serine/threonine-protein phosphatase 2B regulatory subunit
Organism
ago  Ashbya gossypii (Eremothecium gossypii)
Brite
Protein phosphatases and associated proteins [BR:ago01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     AGOS_AER096C
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
V:complement(join(821575..822050,822115..822166))
Genome map
AA seq 175 aa AA seqDB search
MGSAPSKILEDLLDDTNFDREEIERLRKRFMKLDRDSSGSIDKNEFMSIPGVSSNPLAGR
IMEVFDADNSGDVDFQEFISGLSVFSGRSDKEEKLRFAFKIYDIDKDGYISNGELFIVLK
IMVGNNLEDEQLQQVVDRTIMENDVDGDGKLSFEEFKSAVETTEVANSLTLQCDI
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
atgggttctgctccctctaagatcttggaggacttgcttgatgatacgaactttgaccgg
gaagagatcgaacggcttcgcaagaggtttatgaagcttgaccgagatagttcggggtcg
atagacaaaaatgagtttatgtcgatccccggagtgtcgtccaacccgctagcgggacgt
ataatggaggtgtttgatgcggacaatagcggggacgtggacttccaggagtttattagc
gggctatcggtgttcagtgggcgcagcgacaaggaggagaagctgcgttttgcgttcaag
atctatgacattgacaaggacggatatatctcgaacggagagttgttcattgtgctaaag
attatggtggggaacaacctcgaggacgagcagttgcagcaagttgttgaccgcacgatc
atggagaatgatgtggatggtgacggaaagttaagcttcgaggagttcaagagtgcggtg
gagaccactgaggtcgcaaactctttgaccttgcagtgtgacatatag

DBGET integrated database retrieval system