KEGG   Ashbya gossypii (Eremothecium gossypii): AGOS_AER124WHelp
Entry
AGOS_AER124W      CDS       T00167                                 

Definition
AER124Wp
Orthology
K14676  
lysophospholipid hydrolase [EC:3.1.1.5]
Organism
ago  Ashbya gossypii (Eremothecium gossypii)
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:ago00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    AGOS_AER124W
Enzymes [BR:ago01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     AGOS_AER124W
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
V:872566..877134
Genome map
AA seq 1522 aa AA seqDB search
MVDGTYVNSSVEAISGEADTAAVAELANQMVMNFLYESSSWLAQSTGPFLWKGFRFLFLR
LPSSLLVYLINGTVPFYLVVLGSVFTPIIVYLILRSRVLSAYSRLKGDNEDEVIDKKKQL
VNDSEAMLMGGPDGKRRSGFSSYLDEFLSAIKIFGYLDKLVFHELTKSMRTQRLEQGEVM
LLDDSVGFAIVVEGGLHIYHKIAHSQGSTRESMPLPEDRSFDSNEDDLTINGERFQLLNK
VKAGNPVSSLVSILKLFTDNHTPTVVDSSKSSPKQSAQVPIRQLISPFLDGNVERNKATL
NMKQVPTAEYEIPSAERAGSNVSSFTQQLYESMLPKDHAAEDVREPLPEIVAYAASDCAI
AVIPASSFKRLMVKYPRSASQIIQVILTKLYRVTFQTAHSYLGLTKEIMHTEVVLNNSTN
FELPYYLQEAILRKIKNGSKESSVQESIHRATLRSKNVHAHNSPTPNKISRHIALESRDQ
YNPGDLLSNVPLSRKGSKTASSSSVSIPRISSLRHQKEAASSPLATLRRLEGNDSQNFAP
LSSSSPMSVSEKPSVVGGGAHDNISQISFSSALEETEESSWRMALVESMFGYLGITNESI
MPPTEDLLFLNNRASSGSSVCSVSSYSHPQTINQDLFRCLSPELVRTKKKAPRQKYTEEM
PINVDFNTAKEEFAEGLETLFIPSGATIVEQNGNNKGLYYIVSGELLVCWKNEEDNIEYV
LYTVKPGGIAGYLASLIGFKSFVSLRAKTDLYVGFLPIEVLERLCDKYFMIYLKIAETLT
KLLSPKILKLDYALEWIHLEASETLFNQNDPANAIYVVLNGRLRQLHQKSKNEERLSRPT
TQRKKRKDDNQPNVQVVGEYSQGCSFGEVEVLTAMNRVSTVVAVRDTELARIPRTLFEVL
ALEHPSIMIRVSRLVAHKILQRSSDIREPTKIVNSANGYRYDFNLTIPPSAGTSSWGNNS
DGGSISYKTITILPITYGLPVEEFANKLVSTFRQVGRSTIGLTQCTTLKHLGRHAFDKLA
NLKQSGYFAELEELYELVVYIADTPVKSSWTSTCISQGDCILLLADASSDPEIGEFERLL
INNRTTARTELLLLHPERYVEPGLTHKWLRKRTWVHQHHHMQFVSSQNPSERVDSKAPPI
PGAPPNLIGRLKKRERLNQLTKRTQENFARLLPDSIKLTVENISMKYIQKKQKYYTPVSA
HKNDFLRLARILSGQAIGLVLGGGGARGISHLGILKAIEEHGIPIDMIGGTSIGSFVGGL
YAKDYDLVPTYGRVKKFAGRIGSIWRMLSDLTWPVTSYTTGHEFNRGIWKAFGDIRIEDF
WIQYYCNSTNITESMQEIHTFGYAWRYVRASMSLAGILPPITDNGNMLLDGGYLDNLPVL
EMKARGCKTIFAVDVGSVDDRTPMDYGDSLNGFWIVLNRWNPFSKHPNVPSMAEIQMRLG
YVASVNALEKAKTTQGVVYFRPPIEDYATLDFAKFEEIYQVGTAYGATFLHELEQNGKLP
RIPGNEPANGPGIHLLHRRNSI
NT seq 4569 nt NT seq  +upstreamnt  +downstreamnt
atggtagatggcacgtatgtgaactcttctgtcgaggctatctcgggggaagcagataca
gctgctgttgcagagctcgcaaaccagatggttatgaactttctgtatgaatcgtcaagc
tggcttgcacagagcacgggtcctttcctctggaaggggtttcgatttttgtttctgagg
ctgccgtcctcattgctggtataccttataaatgggacggttcctttctacctggtggta
ctgggctctgtgttcacgccgatcatagtgtaccttattcttcgcagcagggttctgtcg
gcgtactcgcggctcaagggcgacaacgaggatgaggtgatagacaagaagaaacaactt
gtgaacgactccgaggcgatgctgatgggtggccctgacggcaaacggcggtccgggttc
tcatcttacctcgacgagtttctgagcgctatcaagatattcggttatctagacaagcta
gttttccatgagctcacgaagtcaatgcggacacagcgcctggaacagggagaagtcatg
ctactggacgactccgtgggattcgcgattgtggtggaaggtggcctacacatatatcac
aagatcgcgcactcccagggtagtacccgtgagagcatgcccctgccagaagatcgctcc
tttgacagtaatgaggatgacctaacaatcaatggggaacggtttcagctcttaaataaa
gtaaaggccggtaacccagtttcatcattggtgagcatactgaagctgtttacagataat
cacaccccgaccgtcgtcgatagctcgaagtcttcaccgaagcagagtgcgcaggtccct
attcggcagctcatctctccttttctggacggtaacgttgagcggaacaaagcgacattg
aacatgaagcaagtacccaccgctgaatacgaaatcccttcagctgagcgtgcaggctcc
aacgtgtcctctttcacgcagcagctttatgagtccatgctgccgaaagaccatgcagct
gaagatgtccgcgaaccgctacctgagatcgtggcttacgctgcaagtgactgcgccatt
gccgtgataccagcaagttctttcaagcgattgatggtgaagtacccgcgctctgcatca
cagatcatacaggtaattctgacaaaactgtatcgagttaccttccagactgcccactct
tacctgggcttaaccaaggaaatcatgcataccgaggttgtactaaacaatagcaccaat
tttgagcttccctattacctacaggaggcaatccttcggaagataaaaaacggctccaag
gagagttctgtgcaggagagcatacatcgtgctactctgcgcagcaagaatgtgcatgcg
cacaactcgcctacgccaaacaaaatatcgcgccatattgcgttggaatcgagggatcag
tataatcccggagacctactatccaatgttcccctttctagaaagggatccaagactgct
agtagctcttctgtcagtattccgaggatttcatctctgagacatcagaaagaagcagcg
agcagcccacttgccacactccgccgccttgaaggaaacgatagccagaactttgcgccc
ttgagctcatcttctccaatgtcggtgagtgaaaagccgtcggtggtgggaggaggagca
catgataatataagtcagatatccttttcctcagccttggaggaaacagaagagtcttcc
tggcgcatggcccttgttgaaagcatgtttggctatttgggtattactaatgagagtata
atgcctcctactgaagatctattattcttaaacaatcgtgcgtcgtctggttcttcggtt
tgttctgttagctcttactctcatcctcagacgatcaaccaagatcttttcaggtgccta
tccccggagttggtacgtactaagaaaaaagcaccacgtcaaaagtacaccgaagagatg
cccataaacgttgattttaataccgcgaaggaagagttcgccgaggggttggagacatta
ttcataccaagtggtgccacgatagtggagcagaatggaaataataaagggttgtactac
atcgtctccggtgaattgctagtctgttggaaaaacgaggaggataacatcgagtacgtt
ttgtacactgtgaagcccgggggaatagccggttatcttgcctcacttatagggttcaaa
tcatttgtgtcattgagagccaagacagatctttatgtggggtttttacccatagaagtt
cttgaaagattatgtgataaatatttcatgatatatttgaagattgctgaaacattaaca
aagcttctaagtccgaagatattgaagttggattatgcacttgagtggatacatttagaa
gcgtctgagactttgtttaatcaaaatgatcctgcaaatgctatttacgtcgttctaaat
ggaagattgaggcaacttcatcaaaaatccaagaatgaggagcggctcagtcgaccaact
acacagcgaaagaaacggaaagatgacaaccaaccgaatgtacaggtggttggagagtac
tcacaaggatgtagctttggtgaagtggaagtattgaccgcaatgaatcgtgtctcgact
gttgttgcggttagagacactgagttggcccgtatacctcggacactatttgaggtgttg
gctttagaacatccctctattatgattcgcgttagcagactcgtcgcccataagatactt
cagagaagctccgatatacgcgaacccaccaaaattgttaacagtgctaatggatatagg
tatgacttcaacctaaccataccaccttctgcagggacgtccagttggggcaacaatagt
gatggcgggtctataagctataaaaccattaccattttgccaattacctatggtcttcct
gtggaggagtttgcaaataaacttgtgtccacatttcgtcaggttggaaggtcgaccatt
ggcttaacgcagtgcaccaccttgaagcatctcggtcggcatgcctttgacaagttggcg
aatctgaagcaatctggttactttgcggaactcgaagaactatatgagctggttgtgtac
attgcagatacacccgtgaaatcttcatggacctccacttgcatatcacagggcgattgt
atccttctactagccgatgcctctagcgatccagaaataggcgaattcgaacgtctactc
atcaataatcggaccactgcgcgtacggagcttttgttgcttcatcccgaaagatacgtg
gaacctggactaacgcataaatggctgcgtaagagaacttgggtgcatcagcaccatcat
atgcagtttgtgagctcccaaaacccatctgaaagagtcgactcgaaagccccacccatt
ccgggtgctccgcctaaccttatcgggcgcctgaagaaaagggaacgcctcaaccaattg
acgaagcgaacgcaggagaactttgccagattgcttccagattctattaaattgacggta
gaaaacatttcgatgaagtacatccagaagaagcagaaatactacacacctgtgagtgca
cataagaacgacttcctacggcttgcgcgcattttgtctggccaggccatcgggcttgtt
ctgggtggtggcggcgcgagagggattagccatctgggtatattgaaggccattgaagag
catggaatccctatagatatgatcggcggcacctcgatcggttcctttgtcggcggccta
tatgctaaggactacgacctggtgccaacctacggtagggtaaagaagtttgcagggagg
attggctcgatatggcgcatgctctcggacctcacctggcccgtgacgtcgtataccacc
gggcatgagttcaaccgcggtatctggaaagcgttcggcgacattcgtatagaggatttc
tggatccagtactactgtaattcgaccaacatcaccgagtccatgcaggaaatccacacg
ttcggctatgcctggcgctatgtccgtgcctccatgtccctggccggcattctgccgccg
ataaccgacaacggcaatatgctgctagacgggggctacctggataacctgcccgtgctc
gagatgaaggcgcgcggatgcaagaccatcttcgcagtcgatgttggctcggtggacgac
cggacccccatggactacggtgactcgctcaatggcttctggatcgttttgaaccgctgg
aaccctttctccaagcacccgaacgtccctagcatggcggagatacagatgcggctgggc
tacgtcgcctccgtcaacgcgctcgagaaggcaaagaccacgcagggcgtcgtctacttc
cgcccccccatcgaggactacgcaaccctcgactttgccaagttcgaggagatataccag
gtcggcaccgcgtacggcgccaccttcctccacgagctcgaacaaaacggcaagctgccg
cgcattccgggcaacgagccggccaacggccctggcatccacctgctgcaccgccgcaac
agcatctag

DBGET integrated database retrieval system