KEGG   Ashbya gossypii (Eremothecium gossypii): AGOS_AER228CHelp
Entry
AGOS_AER228C      CDS       T00167                                 

Definition
AER228Cp
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
ago  Ashbya gossypii (Eremothecium gossypii)
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:ago00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    AGOS_AER228C
   01230 Biosynthesis of amino acids
    AGOS_AER228C
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AGOS_AER228C
  Energy metabolism
   00680 Methane metabolism
    AGOS_AER228C
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    AGOS_AER228C
Enzymes [BR:ago01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     AGOS_AER228C
Exosome [BR:ago04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   AGOS_AER228C
  Exosomal proteins of melanoma cells
   AGOS_AER228C
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
V:complement(1058645..1059547)
Genome map
AA seq 300 aa AA seqDB search
MTENRKTVKLFLLRHGESELNHAKIFCGWIDAHLTDKGKDQARSSASLIASFCREHGIEP
PLVGYTSRLLRTIETMQVIMKELRRAAVFQTVVDTADALAVVDKVTAAGQTPVLQVWTLN
ERHYGSWQGQRKSSVLEQFGKSDYMLIRRDYNGRPPAVDLGREMIQEDNEQGPLTGYDFK
EPNRRLKYGPELEKAIELPRNESLADVIKRLAPFLNEVVLKLLHELGESAIIVAHGSTVR
SVLKILANISEEDIKDIDIPTGNPLVIELNASDMSFVRHFYLDPESARKEAENVRNEGCN
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atgacggagaataggaagacggtcaagctgtttcttcttcggcatggcgagtcagagctg
aaccatgcgaaaatattctgtgggtggatcgatgcccaccttacagataaaggaaaggac
caggcgagaagttcagcatctcttatcgcctcgttttgcagggagcatggaattgaacct
ccactcgtaggttatacatcgaggctacttcggactattgaaaccatgcaagtgatcatg
aaggagcttcgcagagcggccgttttccaaaccgttgtagataccgcggacgcattagca
gtagttgacaaggtaactgcagccggccagacccctgttctacaagtttggacgctaaat
gaacgccactatggttcctggcagggtcaaagaaagtcaagtgttttagaacagtttggg
aagagtgattacatgctcatcagaagagactacaatgggcggccacctgccgttgattta
ggtagggagatgatccaggaggataacgaacaagggccactgacaggctacgacttcaag
gagcccaaccgccggctcaagtatgggccagagcttgaaaaagcaattgaacttcctcgt
aacgaatctctagcggatgttatcaaaagattggcacccttcttaaatgaagttgtgctg
aaattacttcatgaattaggagaaagtgccattatagtagcacatggaagtacagtaagg
tctgttcttaagattttagcaaacatctcggaagaggacataaaggacattgatattcct
accggaaatcctctggtcatcgaactgaacgcaagtgacatgtctttcgttcggcacttt
tatttagaccccgaatctgctaggaaggaggcggagaacgtgcgaaacgaaggttgtaac
tga

DBGET integrated database retrieval system