KEGG   Ashbya gossypii (Eremothecium gossypii): AGOS_AER232CHelp
Entry
AGOS_AER232C      CDS       T00167                                 

Definition
AER232Cp
Orthology
K04464  
mitogen-activated protein kinase 7 [EC:2.7.11.24]
Organism
ago  Ashbya gossypii (Eremothecium gossypii)
Pathway
MAPK signaling pathway - yeast
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway - yeast [PATH:ago04011]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
V:complement(1065450..1067159)
Genome map
AA seq 569 aa AA seqDB search
MSDAVERHTFKVFTQDFMVDKRFQLIKEIGYGAYGIVCSARFMESVEDTTVAIKKVTNVF
SKALLCKRSLRELKLLRHFRGHKNITCLYDMDIVLLPDGSFNGLYLYEELMECDMHQIIK
SGQPLTDAHYQSFVYQILCGLKYIHSADVLHRDLKPGNLLVNADCQLKICDFGLARGYSE
NPIENDQFLTEYVATRWYRAPEIMLSYQGYTRAIDVWSCGCVLAELLGGRPIFKGKDYVD
QLNRILQVLGTPPEETLKRIGSKNVQDYIHQLGYIPKVPFERLYPNANPDAADLLERMLA
LDPKTRITVDEALEHPYLSIWHDPSDEPVCCKKFDFSFESVNEMEELKRMVIEEVKDFRR
FVRQPNIRDTSLQEQEEQQPQQPQQPQQPQPEQPQHQRQHQQAQAQAQAQAHEQQQQHHR
TQYQRSGAVQRQPQTVEHGQHLQHRSGHHSEHLQRAHGQQEQYLPKKDDSRAFQSRPVGT
SISDSRSSYEEHDYVQQMMFAHSPTLAHDSFIGIHSENLPEHNTDFPPRPQENMLASPMG
FSDGTHSNAEFGDFLDLEKELEFGLDRKI
NT seq 1710 nt NT seq  +upstreamnt  +downstreamnt
atgtcggacgcagtggagcgtcatacattcaaggtgttcacccaggacttcatggtggac
aagaggttccagctaatcaaagagataggctatggcgcgtacgggattgtgtgctcagcc
cggttcatggagtcggtggaagacacaacagtcgccatcaagaaagtgacgaacgtgttc
tcgaaagctctactctgcaaacggtcgctaagggagctgaagctgctgcggcactttcgg
gggcataagaatatcacgtgcctctacgacatggatatcgtgctgcttccagatggctcc
tttaacgggctgtatctatacgaggaattgatggaatgtgatatgcaccagatcatcaag
tccgggcagccgctgacggatgcgcactaccagagcttcgtctaccagattttatgcggc
ctcaagtatatccactctgcggacgtgctccatcgagatttgaagccaggaaacctactt
gtgaatgctgattgtcaactcaagatatgtgattttggtctagctcggggatatagcgaa
aaccccatcgaaaacgaccagttcctgacggaatatgttgccacgcggtggtatcgcgcg
ccagaaataatgttgagttaccagggctacacccgcgcgatagatgtgtggtcctgtggt
tgtgttctagcagaattattaggcggaaggccgatcttcaaagggaaggactacgttgat
cagctgaacagaatccttcaggtgcttggtactccaccagaagagacgctaaaacgcata
ggttccaaaaacgtacaggattacattcatcaactagggtacattccaaaggtgcccttc
gagcggctgtatcccaatgccaatccagatgcggcggatttgttggaacgtatgttggcc
ctcgatcctaagacacggattaccgttgacgaagctctggagcacccatatctgtcaatc
tggcatgatccaagcgatgagccagtgtgctgcaagaagttcgactttagttttgaaagt
gtgaatgagatggaagaactgaagcggatggtcattgaagaagtaaaggactttagaagg
tttgttagacagcccaatataagggacacgtcgctgcaggaacaggaggaacaacaacca
caacaaccacaacaaccacaacaaccacaaccagaacagccccaacatcagcggcagcat
cagcaagcacaggcacaagcacaggcacaagcgcatgagcagcaacagcaacaccaccgt
acacagtatcagcggtcgggtgctgtgcaacgtcaaccacaaacggtggaacatggacaa
catttacaacaccgcagcggacaccatagcgagcatctccagcgagcacatggccagcag
gaacagtacttacctaaaaaagacgattccagggcttttcaatcccgtccagtgggtacg
tccatctctgacagcagaagctcatacgaggagcatgattatgtacagcaaatgatgttt
gctcattctcctactttagcccacgattctttcatcgggattcattcagaaaacctcccc
gaacacaatacagacttccccccacgaccacaagagaatatgttagcatctcccatggga
ttttcggatggtacacattctaatgcggaatttggcgacttccttgatctggagaaagaa
ttggaatttggtttggatagaaaaatttga

DBGET integrated database retrieval system