KEGG   Ashbya gossypii (Eremothecium gossypii): AGOS_AER270WHelp
Entry
AGOS_AER270W      CDS       T00167                                 

Definition
AER270Wp
Orthology
K00898  
pyruvate dehydrogenase kinase 2/3/4 [EC:2.7.11.2]
Organism
ago  Ashbya gossypii (Eremothecium gossypii)
Brite
Enzymes [BR:ago01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.2  [pyruvate dehydrogenase (acetyl-transferring)] kinase
     AGOS_AER270W
Protein kinases [BR:ago01001]
 Serine/threonine protein kinases: Atypical group
  PDHK family [Table]
   AGOS_AER270W
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
V:1130460..1131929
Genome map
AA seq 489 aa AA seqDB search
MNATGKFSSSLLQQIWRCAERPQTPVSLKQMCQFGQRPNPGELFKASCFLLEELQVRLAH
RITEMDEFPSGLNKMEDVLRVRNWYIKSFQDLQEFAGSVDTREGRLYQMLYAGRKPEVIE
REPLARILELLYRDDELQEAPYADDGRAAACGLVRPPAQYYSQLPEDLVMTGHADREAFY
KIWPQEILLFNDSYYKMLKRIKVRHDATVVTLARGLLRWKRTQKNNVVDASIKGYLDRFY
MGRIGIRMLIGQHLSLLEQAMHSDLACEHVPGAVGSDADYVGIVCTRTKVAQVADIAIDR
ARHICAEYYNLYEAPKVELHTIPIKRDDSSGLREIEFTYVPSHLVHMLFEVLKNALRATV
ESTIQKNPGVTDYDSLRFPPVKVIISEGTEELAVKISDEGGGIARSNLPLVWTYLYTTMT
DDEQDSLIDGDSTLSGSCPPMAGYGYGLALSRLYARHFGGDLRLLSMDGYGTDVYLHLNR
LESCKECLT
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atgaatgcgacgggcaagttcagcagtagcctgctgcaacagatatggcggtgtgcggag
cgtccacaaaccccggtgtcgcttaagcagatgtgccaattcggacagcgacctaaccct
ggtgaactgttcaaagcgtcctgctttcttctagaggaactgcaggtgaggttggcacac
cgtatcaccgagatggacgaatttccatccgggctaaataagatggaggatgttctgcgg
gtgcgcaattggtacatcaagtctttccaagacctgcaggagttcgcgggaagcgtcgac
acaagggagggacggttatatcagatgctttacgccgggaggaagccagaagtgatcgag
cgcgagccattggcccggattctggaactcctttacagagatgatgagttgcaggaggca
ccgtatgctgatgacggcagggctgcagcgtgtgggctggtgagaccaccggcccagtac
tactcacagctaccagaggatcttgtgatgacagggcacgcagatagggaggcattttac
aagatatggccgcaagaaatcttgcttttcaatgatagttactacaagatgctgaaacgg
atcaaagtgcgacacgatgcaacagtggttacactagctcggggactgctccgatggaaa
cgaacgcagaaaaataacgttgtggatgcatctatcaagggatacctcgataggttctat
atggggcgtatcggaattcggatgctgattggacaacatctttccttgttagagcaggct
atgcactcagatttggcgtgcgagcacgtgcccggtgctgtgggctctgacgccgactat
gttggtattgtttgcacgaggaccaaagttgcacaggtcgctgacattgcgatcgatcgc
gcacgtcatatatgtgctgaatactacaatctgtacgaggctcccaaagtagagctgcat
acgatcccaataaaacgcgatgactcaagcggactgcgagaaatagaattcacctacgtg
ccctcccacctggtgcatatgctctttgaggtgcttaaaaatgcgctccgcgccaccgtg
gagagtacgatccagaagaatccgggcgtgaccgattacgattctctgaggtttccgcca
gtgaaggtcatcatcagcgagggaactgaggagctggcagtcaagatctccgatgaaggc
ggcggaattgcgcggtcgaacctaccattggtatggacatatttatacaccaccatgact
gacgacgagcaagacagtctcattgatggggattccacactatctggctcctgtccccca
atggccggttacggatacggtctggcattgagcaggctttatgctagacattttgggggc
gatttgcggcttctctccatggatggatacggcacagacgtatacttgcatttaaatagg
ctagagtcctgtaaggaatgtcttacatag

DBGET integrated database retrieval system