KEGG   Ashbya gossypii (Eremothecium gossypii): AGOS_AER297CHelp
Entry
AGOS_AER297C      CDS       T00167                                 

Definition
AER297Cp
Orthology
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
ago  Ashbya gossypii (Eremothecium gossypii)
Brite
Enzymes [BR:ago01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     AGOS_AER297C
Transcription machinery [BR:ago03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     AGOS_AER297C
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
V:complement(1181482..1182840)
Genome map
AA seq 452 aa AA seqDB search
MSMPLKRRNKQSQGNEPKKIKVEEQEAEEKISEDIPVTDLKEPEALADIQSTSGGDEVSE
GAQGDADPAEKSVGGLKEEVEDEEKGIVKFMFDGVEYKFRERPSVIEEKEGKIEFRVVNN
DNTRENMMVLTGLKNIFQKQLPKMPKEYIARLVYDRSHLSMAVIRKPLTVVGGITYRPFE
KGEFAEIVFCAISSTEQVRGYGAHLMNHLKDYVRATTNIKYFLTYADNYAIGYFKKQGFT
KEITLDKSVWMGYIKDYEGGTLMQCFMLPRIRYLDAAKILLLQEAAIQRKIRTISRSHIV
RPGLRQFEDLDNIEPIDPMSVPGLREAGWTPEMDELAQRPKRGPHYATMQNVLTELQNHA
AAWPFLQPVNRDEVPDYYEFIKEPMDLSTMEIKLENNRYEKMEDFIYDARLIFNNCRAYN
GENTSYFKYANRLEKFFNTKMKEIPEYSHLLD
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atgagcatgccgttgaaaagaaggaacaaacaaagtcagggaaatgaaccaaagaaaata
aaagttgaagagcaggaggcagaggaaaagattagcgaagacatacctgttacagatctc
aaggagcctgaggctttagcagacatccagagcacgagtggcggcgatgaggtttccgag
ggtgcacagggggatgctgaccccgcagagaagagcgtcggcgggttgaaggaggaggtg
gaagatgaggagaaaggcatagttaaatttatgtttgatggggtggagtacaagttcagg
gaacggccgagcgtgattgaggagaaggaggggaaaattgaatttcgggtggtgaataac
gacaacacgagggagaatatgatggtgctgactgggctcaagaatatcttccagaagcag
ctgcccaagatgccgaaagagtatatagctcgcctggtatatgataggtcacacctctcc
atggctgtaatacgaaagccgctcaccgttgtaggtggcatcacatatcgtccgtttgaa
aagggagagtttgcagagatcgtattctgcgcaatcagttcaacggagcaagtgcgcggc
tatggtgctcatctgatgaatcacttgaaggattacgtgcgcgcgaccacgaacataaag
tactttctaacctatgccgataactacgccattggctattttaaaaagcagggcttcacg
aaggagattactctagacaagagcgtgtggatgggttatattaaggactacgagggcggt
actctgatgcagtgctttatgctaccacgtatacgataccttgatgctgcgaagatactg
ttgctccaggaagccgcgatacagcgtaagatccgcaccatatcaaggagccacatagta
cgtccggggttgaggcaattcgaggacttggacaacatagagccaattgacccaatgagc
gtgcctgggctgcgagaagctggctggactcccgaaatggatgagttggcacagagacct
aaacgtggtccgcattatgcgacaatgcaaaacgtcctcacagagctacagaatcatgcc
gccgcatggccattcctgcaacctgtgaatagggatgaggtcccagactactacgagttc
atcaaagaaccaatggacctaagcaccatggaaataaaactcgagaacaaccgatatgaa
aaaatggaggattttatctacgacgcacgcctcatattcaacaattgcagagcttacaac
ggcgagaatacatcctatttcaagtacgctaataggctagagaagttcttcaacacgaag
atgaaggaaataccagagtactcgcatctactagattag

DBGET integrated database retrieval system