KEGG   Ashbya gossypii (Eremothecium gossypii): AGOS_AER309WHelp
Entry
AGOS_AER309W      CDS       T00167                                 

Definition
(RefSeq) AER309Wp
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
ago  Ashbya gossypii (Eremothecium gossypii)
Pathway
ago00230  Purine metabolism
ago01100  Metabolic pathways
Module
ago_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:ago00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    AGOS_AER309W
Enzymes [BR:ago01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     AGOS_AER309W
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_16 AAA_18 AAA_33 AAA_22 MMR_HSR1 ABC_tran RsgA_GTPase AAA_29 AAA_28 RNA_helicase NACHT AAA_14 AAA AAA_24 AAA_30 NTPase_1 DUF2075 T2SSE cobW Viral_helicase1 KAP_NTPase AAA_23 ATPase_2 Cytidylate_kin Zeta_toxin MobB AAA_17 TsaE dNK Rad17 Adeno_IVa2
Motif
Other DBs
NCBI-GeneID: 4621378
NCBI-ProteinID: NP_985165
UniProt: Q756F7
Position
V:1210142..1210699
Genome map
AA seq 185 aa AA seqDB search
MPRPIVISGPSGAGKSTLLKKLFAEFPERFGFSVSSTTRAPRPGEVQGKDYNFASVEEFQ
AMIAQKKFIEWAQFSGNYYGTTVAAVRKVIDSGKICILDIDMQGVKSVKQTDLHARFLFL
APPSLDSLRERLVGRGTETEESLNKRLAAAEAEMAYAATGAHDRIVVNDDIDRAYAELKE
FILNE
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
atgccacgccctatcgttatctccggccccagcggtgctggcaagtcaacgcttctgaag
aagctattcgcagagtttcccgaacggtttgggttctccgtctcgtcgaccacgcgggcg
cctagaccgggcgaggtgcagggcaaggattacaactttgcctccgtagaggagtttcag
gcgatgattgcgcagaagaagttcatcgagtgggcgcagttctccggcaactactacggc
acgaccgtggccgcggtgcgcaaggtcatcgactccgggaagatttgtatcctggatatc
gacatgcagggcgtcaagtccgtcaagcaaacggatctgcacgcgcgcttcctgttcctc
gcgccgccatcgcttgactcgctacgcgaacgcctagtggggcgcggtacggagacggaa
gaatcgctcaacaagcggctagcggctgcggaggcggaaatggcctacgcggccactggc
gcccacgaccgcatcgtggtcaacgatgacatcgatcgtgcgtacgccgagttgaaggaa
ttcatcttaaacgaatga

DBGET integrated database retrieval system