KEGG   Ashbya gossypii (Eremothecium gossypii): AGOS_AER309WHelp
Entry
AGOS_AER309W      CDS       T00167                                 

Definition
AER309Wp
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
ago  Ashbya gossypii (Eremothecium gossypii)
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:ago00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    AGOS_AER309W
Enzymes [BR:ago01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     AGOS_AER309W
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
V:1210142..1210699
Genome map
AA seq 185 aa AA seqDB search
MPRPIVISGPSGAGKSTLLKKLFAEFPERFGFSVSSTTRAPRPGEVQGKDYNFASVEEFQ
AMIAQKKFIEWAQFSGNYYGTTVAAVRKVIDSGKICILDIDMQGVKSVKQTDLHARFLFL
APPSLDSLRERLVGRGTETEESLNKRLAAAEAEMAYAATGAHDRIVVNDDIDRAYAELKE
FILNE
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
atgccacgccctatcgttatctccggccccagcggtgctggcaagtcaacgcttctgaag
aagctattcgcagagtttcccgaacggtttgggttctccgtctcgtcgaccacgcgggcg
cctagaccgggcgaggtgcagggcaaggattacaactttgcctccgtagaggagtttcag
gcgatgattgcgcagaagaagttcatcgagtgggcgcagttctccggcaactactacggc
acgaccgtggccgcggtgcgcaaggtcatcgactccgggaagatttgtatcctggatatc
gacatgcagggcgtcaagtccgtcaagcaaacggatctgcacgcgcgcttcctgttcctc
gcgccgccatcgcttgactcgctacgcgaacgcctagtggggcgcggtacggagacggaa
gaatcgctcaacaagcggctagcggctgcggaggcggaaatggcctacgcggccactggc
gcccacgaccgcatcgtggtcaacgatgacatcgatcgtgcgtacgccgagttgaaggaa
ttcatcttaaacgaatga

DBGET integrated database retrieval system