KEGG   Ashbya gossypii (Eremothecium gossypii): AGOS_AER351WHelp
Entry
AGOS_AER351W      CDS       T00167                                 

Definition
(RefSeq) AER351Wp
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
ago  Ashbya gossypii (Eremothecium gossypii)
Pathway
ago00860  Porphyrin and chlorophyll metabolism
ago01100  Metabolic pathways
ago01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ago00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    AGOS_AER351W
Enzymes [BR:ago01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     AGOS_AER351W
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4
Motif
Other DBs
NCBI-GeneID: 4621422
NCBI-ProteinID: NP_985207
UniProt: Q756B6
Position
V:1280509..1281297
Genome map
AA seq 262 aa AA seqDB search
MGQVEKIIFLKNKTVPEDHYETIFESNGFQTHFVPIITHEHLPDEVRGRLSDANYMKRLN
CLVVTSQRTVECLYEDVLPSLPAEARKSLLNTPVFVVGRATQEFMERCGFTDVRGGSETG
NGVLLAELMLNMIQKGDISSSGTFLLLVGEIRRDIIKKRLESAELEVEEIITYRTSPLHD
ISERFERVFTDNSWVVLFSPQGTNELLPLLRQGAAKIAAIGPTTAQYLLDNATPPILTSP
KPEPSSLYNAIKDYLAASPMGN
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atggggcaagtagaaaaaatcatattccttaagaataagacagtaccagaggaccattac
gagacgatttttgaatcgaatggcttccagactcactttgtacccataataacccatgaa
cacctgccagatgaggttcgcggtcgactatccgacgcgaattacatgaaaaggttgaat
tgtttggtggtaacctctcagaggactgtggagtgtctctatgaggacgttctgccctct
cttccagctgaagcacgcaaatctcttctcaatacgccagtattcgtggttgggcgtgcc
actcaggaatttatggagagatgcggctttacggacgtgagagggggatctgagactggt
aatggcgttttgctagcggagttaatgttaaatatgatccagaagggcgatatcagctcc
tcgggaacttttctgctgctcgtgggcgagatccgccgcgatataattaagaaacggttg
gaatcggcagaactagaggttgaagagataatcacgtatcgtaccagcccactccatgat
attagtgagcgctttgaacgtgtgttcaccgataactcttgggtcgtgctatttagtcct
cagggcaccaatgaactgcttcccctactgagacagggggctgccaagattgcagctatt
ggaccaacaactgcgcaatatctacttgacaatgccactccaccaatattaacgagccct
aaacctgagccctcgagcttgtacaatgcaataaaagattatttggcagcgtctcctatg
ggcaattag

DBGET integrated database retrieval system