KEGG   Ashbya gossypii (Eremothecium gossypii): AGOS_AER351WHelp
Entry
AGOS_AER351W      CDS       T00167                                 

Definition
AER351Wp
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
ago  Ashbya gossypii (Eremothecium gossypii)
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:ago00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
V:1280509..1281297
Genome map
AA seq 262 aa AA seqDB search
MGQVEKIIFLKNKTVPEDHYETIFESNGFQTHFVPIITHEHLPDEVRGRLSDANYMKRLN
CLVVTSQRTVECLYEDVLPSLPAEARKSLLNTPVFVVGRATQEFMERCGFTDVRGGSETG
NGVLLAELMLNMIQKGDISSSGTFLLLVGEIRRDIIKKRLESAELEVEEIITYRTSPLHD
ISERFERVFTDNSWVVLFSPQGTNELLPLLRQGAAKIAAIGPTTAQYLLDNATPPILTSP
KPEPSSLYNAIKDYLAASPMGN
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atggggcaagtagaaaaaatcatattccttaagaataagacagtaccagaggaccattac
gagacgatttttgaatcgaatggcttccagactcactttgtacccataataacccatgaa
cacctgccagatgaggttcgcggtcgactatccgacgcgaattacatgaaaaggttgaat
tgtttggtggtaacctctcagaggactgtggagtgtctctatgaggacgttctgccctct
cttccagctgaagcacgcaaatctcttctcaatacgccagtattcgtggttgggcgtgcc
actcaggaatttatggagagatgcggctttacggacgtgagagggggatctgagactggt
aatggcgttttgctagcggagttaatgttaaatatgatccagaagggcgatatcagctcc
tcgggaacttttctgctgctcgtgggcgagatccgccgcgatataattaagaaacggttg
gaatcggcagaactagaggttgaagagataatcacgtatcgtaccagcccactccatgat
attagtgagcgctttgaacgtgtgttcaccgataactcttgggtcgtgctatttagtcct
cagggcaccaatgaactgcttcccctactgagacagggggctgccaagattgcagctatt
ggaccaacaactgcgcaatatctacttgacaatgccactccaccaatattaacgagccct
aaacctgagccctcgagcttgtacaatgcaataaaagattatttggcagcgtctcctatg
ggcaattag

DBGET integrated database retrieval system