KEGG   Ashbya gossypii (Eremothecium gossypii): AGOS_AER359WHelp
Entry
AGOS_AER359W      CDS       T00167                                 

Definition
AER359Wp
Orthology
K04646  
clathrin heavy chain
Organism
ago  Ashbya gossypii (Eremothecium gossypii)
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:ago00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    AGOS_AER359W
Exosome [BR:ago04147]
 Exosomal proteins
  Proteins found in most exosomes
   AGOS_AER359W
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
V:1298153..1303102
Genome map
AA seq 1649 aa AA seqDB search
MDDIPIEFTELVDLTAVGIAPQSLDFRSTTFESDHYVTVRETRDGTNSVAIVELLNGNHV
TRKNMGGDSAIMHPRQKVISVRANGTIVQIFNLETKQKLKSFQLDEPVIFWSWLNDEVLG
FVTANSLLTCRAFDGEVAQPPARLTARNANLKNTQVINFVANRALDWFAVVGITQENGRI
AGKIQLFSKARNISQAIDGHVATFASLMLDGNPQPVQVFVTGNRNATTGVGELRIIEIDH
AAACPVQYQKKTVDIFFPPDATNDFPLAVQVSENYGVIYILTKYGFIHLYELETGSNLFV
NRITAESVFTATHYNDRNGIACINKKGQVLAVEIDKAHIVPYVLNQLSNVSLALTIASRG
NLPGADDLFHKQFSSLLEKGDYQAAAKVAASSEQLRTQATINKLKNIQAPPGAVSPILLY
FSTLLDKGKLNKHETIELAKPVLQQDRKPLFEKWLKEDKLECSEELGDVVHPFDTTLALA
CYVRSGSHQKVISCLAELQQFDKILPYAEKVGFQPNFVVLISNLLRTSPDKASEFAISLL
QSPQSADKLEVEKVADMFFSQNHIQQGTSFLLDALKGDSPDQGHLQTRVLEINLKHAPQV
ADAILGNNLFSHFDRPLIATLCEKAGLYQRALEHYTDIKDIKRCITHTSVLPVDWLVSYF
GKLNIQQSLACLRALMDADLSGNMSIVTQVATKFSDLIGSDVLVKLFEEYKATEGLYYYL
SSIVNYTDDKDLVFKYIKAAVRTGQFQEVQRIVRDSNTYDPEKVKNFLKDADIPDQLPLV
IVCDKFNFVHDLVLYLYKTKNTKFIEVYIQQVNPAKTPQVVAALLDVNCDERVIQDLLQS
VAGQYPVGELTEEVEKRNRLKILLPILEQTLQSGTQDQAVYNALAKIYIDSNNSPEKFLK
ENNQYDTLNVGRYCEKRDPYLAYMAYDKGDNDEDLVRITNENTMYKYQARYLLKRSDLDL
WAAVLDEDNIHRRQLIEAVIGVGIPELTDPEPVSITVQAFMSAGLKLELIELLEKIILEP
SPFTENQALQGLLMLSSIRYDSSKVLGLIEKLDHFDADEIAPLCLESGLNEEAFAIYDKN
EMHDKALQVLVENMMSLERAETYVEKVDKPVLWSQLGSAQLNSSQISAAIDSYIKAQDPS
NYENVINTTLEFEKYEELIPYLTMARQSLKEPKIDGALILAYAKLEKLNEIENLLNSNNV
ADLEDVGDQLSEQKNYKAAKLCYASISNYSKLATTLVHLKDYQAAVDTARKASNIRVWGQ
VNNACVDNKEFRLAQICGLNLIVHAEELKELVDKYESNGYFEELISLFEAGLGLERAHMG
MFTELAILYTKYEPAKTFEHLKLFWSRINIPKVIAATEQAHLWPELIFLYAHYDEWDNAA
LTVIEKSADSFDHSYFKEIVVKVSNLEIYYKAINFYVKEHPSLLIDLLAVLTPRLDIPRT
IKIFAKSDNLPLIKPFLINVLPKNNSVVNQAYHELMIEEEDYKALQSATQSYDKFDQLAL
AARLEKHELIFFKKIAAQLYRRNKKWSKSLSILTENKLWKDAIETVVISQDSHVAEDLLN
YFLESDNKEAFVALLYSAYNLIRYDYVLEAAWLKGWETLIKPYEISIKKEQFDKIQKLSD
TLATMDLSEKGAKEGQPLLLTNGAAGFNF
NT seq 4950 nt NT seq  +upstreamnt  +downstreamnt
atggacgacatcccaattgagtttaccgagctggtggacttgaccgcggtggggatcgcg
ccgcagtcgctggacttcaggtccacgacgttcgagagcgaccactacgtgacggtgcgc
gagacacgcgatgggacgaactcggtggcgatcgtggagctgctgaacgggaaccacgtg
acgcgcaagaacatgggcggcgactcggccatcatgcatccgcggcagaaggtgatctcc
gtgcgcgccaacgggaccatcgtgcagatcttcaacctggagacaaagcagaagctgaag
tcgttccagcttgatgagccggtgatcttctggagctggctgaatgacgaggtgctgggg
ttcgtgacggcgaactccctgctcacgtgccgggcgtttgacggcgaggtggcgcagccg
ccggcgcggctgacggcgcgcaacgcgaacctcaagaacactcaggtgattaactttgtg
gcgaaccgtgcgctggactggtttgcggtggtgggcatcacgcaggagaacgggcgcatt
gcgggcaaaatccagctattttctaaggcgcgcaacatctcgcaggcgatcgacgggcac
gtcgcgacgttcgcgtcgctgatgctggacggcaacccgcagccggtccaggtgttcgtg
accggtaaccgcaatgcgacgacaggcgtgggcgagctccgcatcatcgaaattgatcac
gcggcagcgtgtcccgtgcagtaccagaagaagactgtggacattttctttcctccggac
gccaccaacgacttcccgctggcagtgcaggtctccgaaaattatggcgtgatctacatc
ctaactaaatacgggttcattcacctttacgagcttgagacgggctcgaatctatttgtg
aaccgcattacggccgagtcggtcttcactgcgactcattacaatgatcgcaacggcatt
gcctgcatcaacaagaagggtcaggtgttagcggttgaaattgataaagcccacattgtt
ccgtatgttctaaatcagttgtccaatgtctcccttgccctgacaattgcctcgcgtggt
aatttgccgggtgcagatgacttattccacaagcaatttagtagtctgctggaaaagggc
gactaccaagccgcagcgaaggtggccgcatcgtcggagcagctgcgcacacaggcaacg
attaacaagttgaaaaacattcaggcccctccaggcgcagtgtcacctattttgttatac
ttttcaactcttcttgataagggaaaacttaacaagcacgaaactattgagcttgccaag
cctgtcttgcagcaagatagaaagcctctatttgagaaatggttgaaggaagataaattg
gaatgttcggaggagctgggtgatgtagttcatcctttcgataccaccttagccctcgct
tgttatgtgagatctggatctcaccagaaagttatttcatgtctagcagagttgcagcaa
ttcgataagatcctcccatatgcagagaaggttgggtttcagcctaactttgtcgtgttg
atatcgaatctactacggacttctccagacaaggcatcggagtttgcaatcagtctattg
caatcaccacaaagcgccgacaaactagaagtagagaaggttgctgatatgttcttttcg
caaaaccacatacaacagggtacctccttccttttggatgctctaaagggtgacagtcct
gatcagggccatcttcagactcgtgttctcgaaataaacttgaaacacgcaccgcaggtg
gcagatgcaattttgggcaacaacctgtttagccactttgacaggccactcatcgccact
ctgtgtgaaaaggctggtttgtaccaaagggctttagaacactatactgacattaaggat
attaagaggtgcattacacacacctctgtccttccagtagactggttggtgtcttacttt
gggaagctaaacatccagcagtctttggcttgtctaagggcgctgatggatgctgatttg
tcaggcaatatgtctattgtaacacaggttgcaaccaagttttctgatctcattggtagt
gatgttttggttaagttattcgaggagtacaaggctaccgagggcctttactattatttg
tcttcgattgttaactacactgatgacaaagatttggtatttaagtacattaaggcagcc
gtgagaacaggccaattccaagaagtccaaagaattgttagagactctaacacgtatgac
ccagagaaggtaaagaacttcttgaaggatgctgatattcctgatcaattgccgttggtt
atcgtgtgtgataagttcaacttcgttcacgacttggtcctatacctatacaagaccaaa
aacaccaagtttattgaagtttatatccaacaagtgaatcctgcaaaaactcctcaggtt
gtggctgctttgcttgatgttaactgtgatgaacgggtcatccaagatctgctacaaagt
gttgcaggtcaatacccagttggtgaattgaccgaagaagttgaaaaacgtaataggtta
aagatcctattgccaatactagagcagacattgcaaagtgggacccaagaccaagctgtc
tacaatgcgttggcgaagatttacatcgactcgaataattctccagagaagtttttgaag
gagaacaaccagtatgataccttgaacgttgggcgttactgtgaaaagcgtgatccatac
ctggcatacatggcgtatgataagggtgataatgatgaggatttggtaagaataaccaat
gagaatactatgtacaagtaccaagccaggtatttgttaaaacgttctgacttggactta
tgggcggccgtgttagacgaagataatattcacaggcgtcaactaatcgaggcagtgatt
ggcgttggcatcccagaactgacagacccagaacccgtttcgatcaccgtgcaagcgttc
atgtcggctggtttgaagcttgaactaattgaactccttgagaagattattttggaaccc
tcgccttttaccgagaaccaagctttgcaaggtctattgatgctttcttcgattagatat
gattcctctaaagtattgggcttaattgaaaaacttgaccattttgatgctgatgagatt
gcaccattgtgcttggaatcaggtttgaatgaagaagcatttgcgatatacgataagaat
gagatgcatgacaaagccttgcaagttttagtggaaaatatgatgtctctagagagggct
gaaacctatgtggaaaaggttgacaagcccgttctatggtcgcaattggggtctgctcag
ttgaatagttcccagattagcgccgcaattgactcttatatcaaagcgcaagatccatcg
aactatgagaatgtcattaatacgaccctggaatttgagaagtatgaggagttaatccca
tatttgacaatggcgagacaatccttgaaagaaccaaaaattgatggggcacttatccta
gcatacgcaaaacttgaaaaactaaacgaaattgagaatttgctcaattccaataatgtt
gcagatctggaggacgttggtgaccagctatctgagcagaaaaactacaaggcagccaag
ttgtgctatgcatcgatttctaactattcgaagttagcaacaaccttggttcacctcaaa
gattatcaagccgcagttgacaccgctcgtaaggcttctaacatcagagtttgggggcag
gtcaacaacgcatgtgttgacaacaaagagttcagactggcacaaatttgtgggctgaac
ttgattgtacatgctgaagagttgaaggaacttgtagacaagtacgaaagtaatggatac
tttgaggaacttatctctttattcgaggccggattaggtttggaaagagcacatatgggc
atgttcaccgaactggcaatcttgtacacaaaatacgaaccggccaagacctttgaacac
ttgaaactcttctggtcgcggatcaacattccaaaagtgatcgcggctactgaacaagcc
cacttatggccagaactaatatttttgtacgcgcattatgacgaatgggacaacgctgcg
ttaacagtgatcgagaaatcagccgattcattcgaccactcgtacttcaaggagattgtc
gttaaggtttctaacttggaaatctattacaaggcgattaacttttatgtcaaggaacac
ccatcgttgttgattgatctgttggcagttttaacgccaaggctcgatattcctagaaca
attaagatctttgcgaagtctgacaacttgcctttgattaagccatttttaattaatgtt
ctaccgaagaacaacagtgtcgttaaccaagcttatcatgagttgatgattgaagaggaa
gactacaaggctctccaaagtgctactcaatcttatgacaagttcgaccagttagctctt
gcagcacgcctggaaaaacatgaattgattttcttcaaaaaaatagcggcacagctgtac
cgtaggaacaagaaatggtcaaagagtttatcaattttaacagaaaacaagctctggaaa
gacgctatcgaaacagtggtcatttcccaggattctcacgttgcagaagatcttttgaat
tacttcttggagtcggacaacaaagaggcttttgtcgccctgttatactctgcctacaat
ttgattagatacgactacgtcttggaagccgcatggctcaaaggttgggaaactctgatc
aagccatatgagatatctatcaaaaaggaacaatttgacaagatacagaagttgtcagac
acgctagctacgatggacctttctgagaagggtgctaaagaaggtcagccacttctactc
accaatggtgcggcgggtttcaacttttaa

DBGET integrated database retrieval system