KEGG   Ashbya gossypii (Eremothecium gossypii): AGOS_AER364WHelp
Entry
AGOS_AER364W      CDS       T00167                                 

Definition
AER364Wp
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
ago  Ashbya gossypii (Eremothecium gossypii)
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Class
Metabolism; Overview; Carbon metabolism [PATH:ago01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:ago00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:ago00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:ago00620]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
V:1311645..1313006
Genome map
AA seq 453 aa AA seqDB search
MLAFTRIAPKVRTLASVARMQLRTYASYPPHTIIGMPALSPTMTQGNLAVWTKKEGDKLS
PGEVLAEVETDKAQMDFEFQEEGFLAKILVPEGAKDVPVNKPIAVYVEEEGDVAAFKDFK
VEESAAESKDAPAKEEAAPAKAAPAAAAPAKAAKKSTGSAASGGRIMASPLAKTIALEKG
ISLKEVTGTGPNGRITKEDVEKYLAKAPKKTESAAAPAAATYEDVPISNMRRVIGSRLLQ
SCQSIPSYPISSDISVAKLLKLRQSLNAAGKDQYKLSINDILIKAIAGAAKRVPEANAYW
LEDQGVIRLFKNVDVSVAVATPTGLITPIVKNAESKGLRSISAEIKELGKRAKENKLAPH
EFQGGTICISNLGMNNAVSSFGSIINPPQSTILSIGTLRRVPVEDAGAEYGFTFEDRMNI
TGVFDHRTIDGARAADFMRELKNIIENPLELML
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
atgttagcgtttactagaattgctcccaaggtgagaacccttgcgtcggtcgcgcggatg
cagttgcgcacttatgcgtcgtatccaccacacactatcatcggcatgccagccctttcg
cccaccatgacgcagggcaacctagcggtatggacaaagaaggagggtgacaagttgagc
ccaggtgaagtgctcgccgaggtggagacggacaaggcgcagatggacttcgagttccaa
gaggagggcttcttggcgaagatcttggtgccagagggggccaaggatgtgccagtgaac
aagccgattgcggtgtacgtcgaggaggagggcgacgtggccgcgttcaaggacttcaag
gtggaggagtctgcagctgagtcgaaggacgctccagcgaaggaggaggctgcgcctgcc
aaggctgcgcctgctgctgctgcgcctgcaaaggcggcaaagaagagcaccggtagcgct
gcttccggcggccgcatcatggcctctccactagccaagaccattgcgttggagaagggt
atttctctgaaggaggtgaccggcaccggtcctaacggccgcatcaccaaggaggacgtc
gagaagtacttggccaaggcgccaaagaagaccgaaagcgctgctgcgccagctgctgca
acgtacgaagacgttcctatcagcaacatgagacgtgtcatcggttcgcgtttgctgcag
tcctgccagagcattccttcgtatcctatctcgtccgacatatcagtggccaagctgcta
aagttgaggcagtctttgaatgctgctgggaaggaccagtacaagctctccatcaatgat
atcctcatcaaggcgattgccggcgctgccaagcgtgtgccagaggccaacgcctactgg
ttggaggaccaaggtgtgatccgcctgttcaagaacgtcgacgtctctgtggccgtcgcc
acccctaccggtctaatcaccccaatcgtgaagaatgccgagtccaagggcctacgctct
atctctgcggagatcaaggagttgggtaagcgtgcgaaggagaacaagcttgcgccacat
gagttccagggtggtaccatttgtatctcgaacttgggcatgaacaacgccgtctcctcc
ttcggctctatcattaaccctcctcagtccaccattctatccattggtaccttgcgcaga
gtccctgttgaggacgccggtgcagagtacggttttacctttgaggacagaatgaacatc
accggtgtgttcgaccacagaaccatcgacggtgccagagctgcggacttcatgcgtgag
ttgaagaacatcatcgagaacccattggaattgatgttgtaa

DBGET integrated database retrieval system