KEGG   Ashbya gossypii (Eremothecium gossypii): AGOS_AER446WHelp
Entry
AGOS_AER446W      CDS       T00167                                 

Definition
AER446Wp
Orthology
K01656  
anthranilate synthase / indole-3-glycerol phosphate synthase [EC:4.1.3.27 4.1.1.48]
Organism
ago  Ashbya gossypii (Eremothecium gossypii)
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ago00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    AGOS_AER446W
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    AGOS_AER446W
Enzymes [BR:ago01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     AGOS_AER446W
   4.1.3  Oxo-acid-lyases
    4.1.3.27  anthranilate synthase
     AGOS_AER446W
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
V:1492948..1494387
Genome map
AA seq 479 aa AA seqDB search
MGKRVVLIDNYDSFTWNLYEYLCRSGAAVEVHRNDKISVAEVAELEPDVVVISPGPGHPA
RDAGISQECIRHFAGRVPVVGVCMGQQCIYEAFGGRVESAGEIVHGKTSELRHDGRGLFQ
GVPQAVAVTRYHSLAGLASTLPAELEVTARTETGVVMGVRHRKYTVEGVQFHPESILTDH
GQLMVRNMLALEGGTWAENDKLQLRAGAGSVLSEIYAQRQEDVAAQMAMPGTGMADLEAS
FRLGVLPGVVDFHERLARDAPRLAVVAEIKRASPSRGNISEALAAEQALAYAEAGVSAIS
VLTEPHWFKGNLQDLTSARRALERHYTAETRPALLRKDFLFSRYQILEARLAGADSVLLI
VKMLTQPQLEDLYLYATQEMGLEPLVEVSNREELDRALMLKPRVIGVNNRDLNSFSVDLD
TTSSLVHHVPAGTLLLALSGISGPQDAARYREEGVQGLLVGEALMRADNVGEFVQRLVQ
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atgggcaagcgcgtggtgttgattgacaactacgactcgttcacgtggaacctgtacgag
tacctgtgccgcagcggcgctgccgtggaggtacacaggaatgacaagatcagcgtggcg
gaggtagccgagctggaaccggatgtggtggttatctcgcctgggccgggccaccctgcg
cgcgacgcaggcatttcgcaggagtgtatacgtcactttgcgggccgagtaccggttgtg
ggggtgtgtatggggcagcagtgcatttacgaggcgttcggcgggcgcgtggagagcgcg
ggagagatcgtgcacggcaagacgtcggagctgcgtcacgacgggcgcgggctcttccag
ggggtaccccaggccgtggcagtgacacggtaccactcgctggctggactggcgtcaacg
ttgccggcggagctggaggtgacggcgcgcacggagacaggcgtggttatgggcgtgcgg
caccgcaagtacaccgtggagggtgtgcagttccacccggagtcgattctgacggaccac
gggcagctaatggtgcgcaacatgctagcgctggaaggcggtacgtgggctgagaacgac
aagctccagctgcgggcaggcgcgggctctgtgctgagcgagatatacgctcaacgacag
gaggacgtggcagcgcagatggctatgccgggaactggtatggcggacctggaggcgagc
tttcgattgggggttctgccgggcgtggtggacttccatgagcggctggcgcgggacgcc
ccgcggctggctgtggtagccgagataaaacgtgcgtctccgtcgcgtggcaatattagc
gaggcgcttgcagcagaacaggcgcttgcatatgcggaggcgggagtttccgccatctcg
gtgcttaccgagccgcactggttcaaaggcaacctgcaagacctaactagtgccagacgc
gcacttgagagacactacactgccgagacgcggccggcgttgctgcgtaaggacttctta
tttagtcgttaccagatcttggaggcgcggcttgcgggcgctgacagtgtgctcttgatt
gtaaagatgttgacgcagccgcagctcgaggacctgtatctttatgccacacaggagatg
gggttagagccgcttgtggaggtcagcaatcgcgaggagctcgatcgtgccttgatgcta
aagccgcgcgttattggcgttaacaatcgcgacctgaactccttctcggtcgaccttgat
accaccagcagtcttgttcaccacgtcccggccggcacgctgctgttggcactttccggg
attagtgggccacaggatgcggcccgctatcgcgaggagggcgtgcaaggcctgctggtt
ggagaggccctgatgagagcagacaacgtcggcgaatttgttcagagactagttcagtga

DBGET integrated database retrieval system