KEGG   Ashbya gossypii (Eremothecium gossypii): AGOS_AFL039CHelp
Entry
AGOS_AFL039C      CDS       T00167                                 

Definition
AFL039Cp
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
ago  Ashbya gossypii (Eremothecium gossypii)
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:ago00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    AGOS_AFL039C
  Metabolism of other amino acids
   00480 Glutathione metabolism
    AGOS_AFL039C
Enzymes [BR:ago01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     AGOS_AFL039C
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
VI:complement(368010..368657)
Genome map
AA seq 215 aa AA seqDB search
MIRIGSRLTPSLRHYTSSSQRITKFTMSGFYDLSPLDAKGEPFPFSQLKGKVVIIVNVAS
KCGFTPQYEELEELYKKYKDQGFEVIGFPCNQFAHQEPATNEEIVQFCKLNYGVTFPVLK
KVDVNGADADPVYVYLKSQKSGLLGFKGIKWNFEKFLVDRKGQVKDRYSSITKPLSLEKT
IETLLKEEGGPAPTATTEATATATADAAKPSGESL
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atgatcaggatcgggagccgtctaacaccaagcttgcgccattacaccagcagttctcag
cgtattacaaagtttacaatgtccggattctatgatttgtcaccactagatgccaaggga
gagcccttccccttctctcagctcaagggcaaggtagtcataatcgtgaatgtggcgtcg
aagtgcgggtttactccgcagtacgaggagttggaagagttgtacaagaagtacaaggac
caagggtttgaggtcattgggtttccatgcaaccagtttgcacaccaggaacctgcgacc
aacgaggagatcgtgcagttctgtaaactgaactacggggtaaccttcccggtgctcaag
aaagtcgacgttaacggcgcggacgcggaccccgtgtacgtgtatttgaagtcgcagaag
tccgggttgttgggcttcaagggcatcaagtggaacttcgagaagttcttggtagaccgc
aaggggcaggttaaggaccgctactcgtctatcaccaagccgttgtcgctcgagaagacg
attgagaccctgttgaaggaggagggcggccctgcgccaactgctactacggaggcgacc
gcgaccgctaccgccgatgccgctaagccttctggcgagagcttgtag

DBGET integrated database retrieval system