KEGG   Ashbya gossypii (Eremothecium gossypii): AGOS_AFL090WHelp
Entry
AGOS_AFL090W      CDS       T00167                                 

Definition
AFL090Wp
Orthology
K04345  
protein kinase A [EC:2.7.11.11]
Organism
ago  Ashbya gossypii (Eremothecium gossypii)
Pathway
Meiosis - yeast
Class
Cellular Processes; Cell growth and death; Meiosis - yeast [PATH:ago04113]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
VI:275767..276807
Genome map
AA seq 346 aa AA seqDB search
MEIMEQELCVAEEARRRSMLPQRSTVSKGKYSLQDFQIMRTLGTGSFGRVHLVRSIHNGR
YYAIKVLKKQQVIRMKQIEHTNDERRMLKVVEHPFLIRMWGTFQDARNLFIVMDYIEGGE
LFSLLRKSQRFPNPVAKFYAAEVTLALEYLHAHNIIYRDLKPENILLDRNGHIKITDFGF
AKEVDTVTWTLCGTPDYIAPEVITTKPYNKSIDWWSLGILIFEMLAGYTPFYDVTPIKTY
EKILAGKVVFPPFFHPDAIDLLGKLITDDLTRRLGNLQSGSQDIKSHPWFSEVIWEKLLA
KDIETPYEPPITAGVGDSSLFDQYPEEHLDYGVQGDDPYASYFVDF
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atggagatcatggaacaagagctgtgcgtcgccgaggaagcgcggcgtcgatcaatgctg
ccgcagaggtcaacggtgtccaagggaaagtacagccttcaagacttccagatcatgcgc
acgcttggcacagggtcctttgggcgtgtgcacttggtgcggtcgattcacaatggacga
tactatgctatcaaagtgctgaagaagcagcaggtgattcggatgaaacagatcgagcat
accaacgacgagcgacggatgctaaaggttgtggagcatccgttcctgatccgcatgtgg
ggcacgtttcaagacgcgcgcaacctgttcatcgtcatggactatattgagggcggcgag
ctcttctcgttgctacgcaaatcacagcgcttccccaaccccgtggcgaagttctacgca
gcggaagtaacgcttgcgctggagtacctgcacgcacacaacatcatataccgtgacctg
aagccggaaaacatcttgctcgacagaaacggccacatcaagattacagactttggcttc
gcgaaggaggtcgacacagtaacatggacactatgcgggacgccggactacattgcgccc
gaggtgatcacgacaaaaccttacaacaagtccatcgactggtggtccctcggcatcctc
atattcgaaatgctcgccggctacacgccgttctacgacgtgacgcccatcaagacctac
gagaaaatcctcgctggcaaagtcgtgttcccgccgttcttccaccccgacgccatcgac
ctcctcggcaaactgatcacagacgacctcacccgccggctcggcaacctgcagagcggc
tcgcaggacatcaagtcccacccctggttctcggaggtcatatgggagaagctgctcgcc
aaggacatcgagacgccctacgagccccccatcaccgccggcgtcggcgactcctcgctc
tttgaccaataccccgaggagcatctcgactacggcgtccaaggcgacgacccgtacgcc
agctacttcgtcgacttctag

DBGET integrated database retrieval system