KEGG   Ashbya gossypii (Eremothecium gossypii): AGOS_AFL185WHelp
Entry
AGOS_AFL185W      CDS       T00167                                 

Definition
(RefSeq) AFL185Wp
  KO
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
ago  Ashbya gossypii (Eremothecium gossypii)
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:ago00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    AGOS_AFL185W
   01230 Biosynthesis of amino acids
    AGOS_AFL185W
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AGOS_AFL185W
   00030 Pentose phosphate pathway
    AGOS_AFL185W
   00051 Fructose and mannose metabolism
    AGOS_AFL185W
   00052 Galactose metabolism
    AGOS_AFL185W
  Energy metabolism
   00680 Methane metabolism
    AGOS_AFL185W
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    AGOS_AFL185W
Enzymes [BR:ago01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     AGOS_AFL185W
Protein phosphatases and associated proteins [BR:ago01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     AGOS_AFL185W
Messenger RNA biogenesis [BR:ago03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     AGOS_AFL185W
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
VI:94988..97864
Genome map
AA seq 958 aa AA seqDB search
MTMEVPLINGTNSVVVTAYSREQYAQCMQFYSAMLRLETLTKGENETVLTNKAVSVRVKY
EEDKSRDQEARERREALAAAATTHDWRGEASTVVFSTVDVAKVRQTLGLCQAYPSELAPL
EVYTLDPQGNVVGFTQTKNAISTFTNVPSVVGPRHARDSMTVSSAGSSTDLRSFGLDTTA
HYPSLPKKSVAGDRKAIAVMTSGGDAPGMNANVRAIVRSVIFKGCRAFTVMEGYEGLVRG
GPEYIKECKWEDVRGWSTEGGTNIGTARCMAFRERSGRLLGAQHLIEAGVDALIVCGGDG
SLTGADLFRSEWPSLIQELLETGKITQAQYDRYRHLNICGTVGSIDNDMSTTDATIGAYS
SLDRICQAIDYLEATAKSHSRAFVVEVMGRNCGWLALMAGIATSADYILIPEKPASSREW
QDQMCDIVSTHRSRGKRTTIVIVAEGAIAADLTPITPKDVHQVLVDRLGLDTRITTLGHV
QRGGSAVAFDRILATLQGVEAVNAVLESTPDTPSPLIVLNENKIMRKPLMESVALTKSVA
DAIQAKDFKKAMGLRDPEFVEHLNNFMAINSADHDEPKLRGEKRLNIAIVNIGAPAGGIN
SAVYSMANYCLSQGHKPFAIYNGWTGLARHESVRTLNWKDMLGWQSRGGSELGTNRTVPE
DADIGMIAYYFQKYKFDGLVIVGGFEAFVSLHQLERARENYPAFRIPMVLIPATLSNNVP
GTEYSLGSDTALNALMEYCDVVKQSAASTRARVFVVDVQGGNSGYLATHAALAVGAQVSY
VPEEGISLEQLSQDIETLRESFEKAHGKGKHGKLILKSTNASKVFTTAVLADVITAEAKG
DFDAKSAVPGHVQQGGLPSPIDRTRGTRLAVRAIGFIEAKQDVIREARENEEAFDCADKA
VSHTAAVLGITGSQLKFTSIRQLYDLETEFSKRMPKVIHWEPTRAIADHLEGRKRVTV
NT seq 2877 nt NT seq  +upstreamnt  +downstreamnt
atgactatggaagtgccgctgattaatggaacgaacagtgtggtggtgacggcgtactca
agggagcagtacgcccagtgcatgcaattctactcggccatgctgcggctcgagacgttg
accaagggcgagaacgagacggtgcttacgaacaaggccgtgtcggtgcgcgtgaagtac
gaggaggacaagtcacgtgaccaggaggcgcgggagcgccgcgaggccctagcggctgcg
gcgacaacgcacgactggcgcggggaggcgtcgacggttgtgttttccacagtggatgtg
gcgaaggtgcggcagacgctcggcttgtgccaggcgtatccgtcggaactggcgcctctg
gaagtgtacaccttggacccccagggcaatgtggtcgggttcacgcagacgaaaaacgcg
atctcgacgttcacaaacgtcccgagtgtggtcggtccacggcacgctcgcgactcgatg
acggtgtcgtcagcgggctcatccacagatctgcgttcgttcggactagatacaactgcg
cactacccctccttgccaaagaagagcgtggccggcgaccgcaaggccattgcggtaatg
acgtcaggtggcgatgcgcccggcatgaacgcgaacgtgcgcgcgatagttcgcagcgtc
attttcaagggatgtcgtgcattcaccgtcatggagggctatgagggtcttgtgcgcggc
gggccagagtatatcaaggagtgcaagtgggaggacgtcagaggctggtctaccgaaggc
ggtactaacatcgggactgcgcgttgcatggcgttccgtgaacgcagcggtaggctgctc
ggtgcacaacacctgatcgaggccggtgtggatgcgttgattgtgtgtggtggagacggc
tcgcttactggtgccgatctattcaggtctgagtggccctccttgatacaggagctgcta
gaaaccggcaagattacacaggcgcagtatgacaggtaccgccacctaaatatttgcggc
acggtaggctcgatcgacaatgacatgtcaaccacggacgcaactattggagcgtactcc
tcgctggaccgtatttgccaggccattgactaccttgaggcaacggcaaaatcgcactct
cgtgcctttgttgtcgaagtaatgggcagaaactgtggttggttggctttgatggcaggt
attgccacaagtgcagactacatcttgattccagaaaagcccgcctcctcccgggagtgg
caagatcagatgtgcgatattgtaagcactcacagatccagaggcaaacggacgacgata
gtcattgtcgccgaaggtgccattgctgccgatctaacccctattactccaaaggacgtc
caccaggtgcttgtagatagacttggcctagacaccagaattaccacgctgggccatgtt
cagagaggtgggtcagcagtcgcatttgaccgtattttggctaccttgcagggtgttgag
gcagttaacgccgttctcgaatctactccagatactccttcgccactaattgtcctaaat
gagaacaaaattatgcgtaagccgctaatggaatcggtcgcattgactaagtctgttgcg
gacgctatccaggccaaggacttcaagaaagctatgggtttgcgtgacccggagtttgtc
gagcatttgaataactttatggctataaactccgcagaccatgatgagccaaagctacgt
ggtgagaagagattgaacattgctattgttaatattggtgccccagctggtggtatcaac
tctgccgtttattccatggcgaactactgtctgtcgcaaggccacaagccattcgctatc
tacaatggctggactggtctagctagacacgagtctgtgcgcacgttgaactggaaagat
atgcttggctggcaatctcgcggtggttccgagttgggaaccaacagaactgtcccagaa
gatgcagacattggcatgattgcctactacttccaaaagtacaagtttgacggcttggtt
attgttggtgggttcgaggccttcgtctccttgcatcaattggagcgggcccgtgagaac
tacccagctttcagaataccaatggtactcattccagcaacactttcgaataacgtcccg
ggcactgagtattcgctcggttcagacacagctctgaatgccctaatggagtactgtgat
gttgtgaagcagtcggcagcctccacaagagcgcgggtctttgtcgtcgatgtccagggt
ggtaactcaggctatctggcaacgcatgctgccttggcggtgggcgcacaggtttcctac
gttccagaagagggtatctcgctggaacagctctcacaagatattgagacgctccgcgag
tccttcgaaaaggcgcacgggaagggtaagcacggtaaactgatcctcaagtctacgaac
gcctcgaaggtgtttacgacggccgttttggctgatgtcatcacagctgaggctaagggt
gattttgacgcgaagtctgctgtcccaggtcacgtgcaacagggcggcctaccatcgcca
atcgacagaaccagaggaactcgtctcgcggtccgtgcgatcggcttcatcgaggctaag
caggacgtcattcgcgaagccagggaaaatgaggaggcctttgactgcgccgacaaggcc
gtctctcacaccgccgccgtcctcggcatcaccggctcccaactgaagttcacctccatc
aggcaactctacgacctggaaacagagttctccaagcgtatgccaaaggttatccactgg
gagcctacccgcgcgattgcggaccatttagaaggccgcaagagggtaacagtttag

DBGET integrated database retrieval system