KEGG   Ashbya gossypii (Eremothecium gossypii): AGOS_AFL185WHelp
Entry
AGOS_AFL185W      CDS       T00167                                 

Definition
AFL185Wp
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
ago  Ashbya gossypii (Eremothecium gossypii)
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Class
Metabolism; Overview; Carbon metabolism [PATH:ago01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:ago01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:ago00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:ago00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:ago00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:ago00052]
Metabolism; Energy metabolism; Methane metabolism [PATH:ago00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
VI:94988..97864
Genome map
AA seq 958 aa AA seqDB search
MTMEVPLINGTNSVVVTAYSREQYAQCMQFYSAMLRLETLTKGENETVLTNKAVSVRVKY
EEDKSRDQEARERREALAAAATTHDWRGEASTVVFSTVDVAKVRQTLGLCQAYPSELAPL
EVYTLDPQGNVVGFTQTKNAISTFTNVPSVVGPRHARDSMTVSSAGSSTDLRSFGLDTTA
HYPSLPKKSVAGDRKAIAVMTSGGDAPGMNANVRAIVRSVIFKGCRAFTVMEGYEGLVRG
GPEYIKECKWEDVRGWSTEGGTNIGTARCMAFRERSGRLLGAQHLIEAGVDALIVCGGDG
SLTGADLFRSEWPSLIQELLETGKITQAQYDRYRHLNICGTVGSIDNDMSTTDATIGAYS
SLDRICQAIDYLEATAKSHSRAFVVEVMGRNCGWLALMAGIATSADYILIPEKPASSREW
QDQMCDIVSTHRSRGKRTTIVIVAEGAIAADLTPITPKDVHQVLVDRLGLDTRITTLGHV
QRGGSAVAFDRILATLQGVEAVNAVLESTPDTPSPLIVLNENKIMRKPLMESVALTKSVA
DAIQAKDFKKAMGLRDPEFVEHLNNFMAINSADHDEPKLRGEKRLNIAIVNIGAPAGGIN
SAVYSMANYCLSQGHKPFAIYNGWTGLARHESVRTLNWKDMLGWQSRGGSELGTNRTVPE
DADIGMIAYYFQKYKFDGLVIVGGFEAFVSLHQLERARENYPAFRIPMVLIPATLSNNVP
GTEYSLGSDTALNALMEYCDVVKQSAASTRARVFVVDVQGGNSGYLATHAALAVGAQVSY
VPEEGISLEQLSQDIETLRESFEKAHGKGKHGKLILKSTNASKVFTTAVLADVITAEAKG
DFDAKSAVPGHVQQGGLPSPIDRTRGTRLAVRAIGFIEAKQDVIREARENEEAFDCADKA
VSHTAAVLGITGSQLKFTSIRQLYDLETEFSKRMPKVIHWEPTRAIADHLEGRKRVTV
NT seq 2877 nt NT seq  +upstreamnt  +downstreamnt
atgactatggaagtgccgctgattaatggaacgaacagtgtggtggtgacggcgtactca
agggagcagtacgcccagtgcatgcaattctactcggccatgctgcggctcgagacgttg
accaagggcgagaacgagacggtgcttacgaacaaggccgtgtcggtgcgcgtgaagtac
gaggaggacaagtcacgtgaccaggaggcgcgggagcgccgcgaggccctagcggctgcg
gcgacaacgcacgactggcgcggggaggcgtcgacggttgtgttttccacagtggatgtg
gcgaaggtgcggcagacgctcggcttgtgccaggcgtatccgtcggaactggcgcctctg
gaagtgtacaccttggacccccagggcaatgtggtcgggttcacgcagacgaaaaacgcg
atctcgacgttcacaaacgtcccgagtgtggtcggtccacggcacgctcgcgactcgatg
acggtgtcgtcagcgggctcatccacagatctgcgttcgttcggactagatacaactgcg
cactacccctccttgccaaagaagagcgtggccggcgaccgcaaggccattgcggtaatg
acgtcaggtggcgatgcgcccggcatgaacgcgaacgtgcgcgcgatagttcgcagcgtc
attttcaagggatgtcgtgcattcaccgtcatggagggctatgagggtcttgtgcgcggc
gggccagagtatatcaaggagtgcaagtgggaggacgtcagaggctggtctaccgaaggc
ggtactaacatcgggactgcgcgttgcatggcgttccgtgaacgcagcggtaggctgctc
ggtgcacaacacctgatcgaggccggtgtggatgcgttgattgtgtgtggtggagacggc
tcgcttactggtgccgatctattcaggtctgagtggccctccttgatacaggagctgcta
gaaaccggcaagattacacaggcgcagtatgacaggtaccgccacctaaatatttgcggc
acggtaggctcgatcgacaatgacatgtcaaccacggacgcaactattggagcgtactcc
tcgctggaccgtatttgccaggccattgactaccttgaggcaacggcaaaatcgcactct
cgtgcctttgttgtcgaagtaatgggcagaaactgtggttggttggctttgatggcaggt
attgccacaagtgcagactacatcttgattccagaaaagcccgcctcctcccgggagtgg
caagatcagatgtgcgatattgtaagcactcacagatccagaggcaaacggacgacgata
gtcattgtcgccgaaggtgccattgctgccgatctaacccctattactccaaaggacgtc
caccaggtgcttgtagatagacttggcctagacaccagaattaccacgctgggccatgtt
cagagaggtgggtcagcagtcgcatttgaccgtattttggctaccttgcagggtgttgag
gcagttaacgccgttctcgaatctactccagatactccttcgccactaattgtcctaaat
gagaacaaaattatgcgtaagccgctaatggaatcggtcgcattgactaagtctgttgcg
gacgctatccaggccaaggacttcaagaaagctatgggtttgcgtgacccggagtttgtc
gagcatttgaataactttatggctataaactccgcagaccatgatgagccaaagctacgt
ggtgagaagagattgaacattgctattgttaatattggtgccccagctggtggtatcaac
tctgccgtttattccatggcgaactactgtctgtcgcaaggccacaagccattcgctatc
tacaatggctggactggtctagctagacacgagtctgtgcgcacgttgaactggaaagat
atgcttggctggcaatctcgcggtggttccgagttgggaaccaacagaactgtcccagaa
gatgcagacattggcatgattgcctactacttccaaaagtacaagtttgacggcttggtt
attgttggtgggttcgaggccttcgtctccttgcatcaattggagcgggcccgtgagaac
tacccagctttcagaataccaatggtactcattccagcaacactttcgaataacgtcccg
ggcactgagtattcgctcggttcagacacagctctgaatgccctaatggagtactgtgat
gttgtgaagcagtcggcagcctccacaagagcgcgggtctttgtcgtcgatgtccagggt
ggtaactcaggctatctggcaacgcatgctgccttggcggtgggcgcacaggtttcctac
gttccagaagagggtatctcgctggaacagctctcacaagatattgagacgctccgcgag
tccttcgaaaaggcgcacgggaagggtaagcacggtaaactgatcctcaagtctacgaac
gcctcgaaggtgtttacgacggccgttttggctgatgtcatcacagctgaggctaagggt
gattttgacgcgaagtctgctgtcccaggtcacgtgcaacagggcggcctaccatcgcca
atcgacagaaccagaggaactcgtctcgcggtccgtgcgatcggcttcatcgaggctaag
caggacgtcattcgcgaagccagggaaaatgaggaggcctttgactgcgccgacaaggcc
gtctctcacaccgccgccgtcctcggcatcaccggctcccaactgaagttcacctccatc
aggcaactctacgacctggaaacagagttctccaagcgtatgccaaaggttatccactgg
gagcctacccgcgcgattgcggaccatttagaaggccgcaagagggtaacagtttag

DBGET integrated database retrieval system