KEGG   Ashbya gossypii (Eremothecium gossypii): AGOS_AFL217CHelp
Entry
AGOS_AFL217C      CDS       T00167                                 

Definition
AFL217Cp
Orthology
K11227  
mitogen-activated protein kinase kinase [EC:2.7.12.2]
Organism
ago  Ashbya gossypii (Eremothecium gossypii)
Pathway
MAPK signaling pathway - yeast
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway - yeast [PATH:ago04011]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
VI:complement(32234..34309)
Genome map
AA seq 691 aa AA seqDB search
MERNTVQRSGTMQTGGSSSASKNYSNINANLHARVKAFQEQRKLQRSGSVGSKSSGQSQD
SAAIQHIVNKPLPPLPPGKGKEAAPPLRRQGSMLKADSRPRSMSSFTGSPPAVGASIADA
EPVASAERPAPVLQANVGQEADSMPVQQSIPLKAAAVPGRQPHQKTHSASDIFQRTSSHV
LPQIPIPLNPIRKAPRPPDAGMGHQRGRQGSHSGIVLGPQSGAGGTGSASDAPKHIMTKS
KPSLSARRGLKLPSGGISLKMKQPLQEFASQPSNKDTALATSGVVPGHRVSKSNPGSLTN
GIQTTSTSSDKQVDTKGTEPSKSGNSGTNSNGGLFAVFSKYVDIKSGSLNFAGKLSLSSQ
GVDFSNGSSFRITLDELEFLEELGHGNYGTVSKVLHKPTNIMMAMKEVRLELDESKFRQI
LMELEVLHKCQSPYIVDFYGAFFIEGAVYMCMEFMDGGSLDKSYDPHEIGGIEEPQLALI
TESVIRGLKELKDVHNIIHRDVKPTNILCSATQGTVKLCDFGVSGNLVASLARTNIGCQS
YMAPERIKSLNPDKATYSVQSDIWSLGLSIVEMALGAYPYPPETYDNIFSQLSAIVDGPP
PRLPKDTFSSDAQDFVRLCLQKIPERRPTYASLLEHPWLKKYRGLDVHMSEYITKRLVQR
QHYLEQSGGDELPKVLPALHGRLVKPQPHIP
NT seq 2076 nt NT seq  +upstreamnt  +downstreamnt
atggagcgcaacacggtgcagagatccggcactatgcagaccgggggcagcagcagcgca
agcaagaactacagtaacatcaacgcgaacctgcacgcgcgtgtgaaggcgttccaggag
cagcggaagctgcagcggtcggggagcgtgggatcaaagtcgtcgggacagtcgcaagac
tcggcagcgatacagcatatcgtgaacaagccgctgccgccgctgccgccgggcaagggc
aaggaggcggcgccgcccctgcggcgacaggggagcatgctaaaggcggactcacggccg
cggtcgatgtcttcgtttaccgggtcaccgcccgcggtgggggcgtccatcgcggacgct
gagccggtagcgagcgcagagcggccggcgccggtgctacaggcgaatgtgggccaggag
gcggactccatgcctgtgcagcagagcattccgctgaaggcggcggccgtgcccgggcgc
cagccacatcaaaaaactcattctgcatccgatatatttcaacgcacgtcgtcgcacgtt
ctcccgcagatacccatacctctgaatccgatcaggaaggccccgcggccgccggatgcg
ggaatggggcatcaacgggggcgccagggctcacattcaggcatagtgctgggcccgcag
agcggtgcagggggcacagggagcgcttccgacgccccaaagcatatcatgacaaagtcc
aagccatccctttccgcgcggaggggactgaaattaccgtctggcggtatttctctgaaa
atgaagcagccactccaagagtttgcatctcagccatcgaacaaagataccgctctggca
acgtcaggagtggtgcctggtcaccgcgtcagcaaaagcaatccggggtcgcttacgaac
gggattcagaccacctcgacgtcctctgacaaacaggtcgatacgaaggggactgaacct
agtaagtctggcaactctggaaccaattctaacgggggcctatttgcagtattctccaag
tatgtcgatattaaatccggatcactaaattttgctggcaagttatcactttcgtctcag
ggcgtggactttagtaatggatctagctttcgaattacattggacgagttggagttttta
gaagaactaggccatgggaactacggtacggtatccaaggtactgcacaagcccactaat
atcatgatggctatgaaggaagttaggctggagctcgacgagtccaagtttagacaaatt
ctcatggaactagaagtcctgcataagtgtcagtccccatacattgtcgacttctacggt
gcattctttattgaaggggcagtctacatgtgcatggaattcatggatggcggttcgttg
gacaagtcttacgacccccatgaaataggcggaatcgaggaaccgcagcttgcccttata
acagagtcagtaatccgcgggttaaaggaattaaaagatgtacacaacattatacaccgt
gatgttaaaccaacaaatatcttgtgctccgcgacacaaggtaccgttaagctctgtgac
ttcggtgtttccgggaacctagtagcatccttggcacgcactaacatcggctgtcaatcc
tacatggcgcccgagcgtatcaagtctttaaatccagataaagccacatactctgtccag
tccgatatttggtccctgggcttatccattgtggaaatggcgttgggtgcgtacccatac
cctcctgaaacatacgacaatatattcagtcagctgagcgccatcgttgacggtccacca
ccccgtttgccgaaggacaccttctcttcggacgcacaggactttgtgcgtctgtgcttg
caaaagatacctgaaaggcggcctacatacgcctcactccttgagcacccatggctgaag
aagtatagaggcctggatgtccacatgagcgaatatatcacaaaaagattggtacaaaga
caacattatcttgaacaaagcggtggggacgaactccccaaagtgttacctgcattgcat
gggaggctggtaaaaccacagccccatattccttaa

DBGET integrated database retrieval system