KEGG   Ashbya gossypii (Eremothecium gossypii): AGOS_AFR007WHelp
Entry
AGOS_AFR007W      CDS       T00167                                 

Definition
AFR007Wp
Orthology
K11839  
ubiquitin carboxyl-terminal hydrolase 8 [EC:3.1.2.15]
Organism
ago  Ashbya gossypii (Eremothecium gossypii)
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:ago00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    AGOS_AFR007W
Enzymes [BR:ago01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     AGOS_AFR007W
Peptidases [BR:ago01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   AGOS_AFR007W
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
VI:450058..452616
Genome map
AA seq 852 aa AA seqDB search
MPHIQESRVWCRSISQLSHLAEQFVTENGTESTDMKLLLQQCVDTLSNYQDECKKIKSVS
KPVPSKELYDLYETAYVYFKIVSLIVLNKIPKLEEYARAKSDAVDRTGKQLLEIYNMLVN
RLVKDDRIAEIKRFVKENSRRDPEAKNEQIGVESGKSIPATLLRNLLMGPSASGTVLLVD
VRPRLDFMRCHIKSSSIICIEPVSFKESYTDIDLGKKSMITSPDAEIALFQDRDKFDYIV
VYTQDSEKNKHNVQQQQLLVDLLINRSFEKALDRTKVFILAGGFSEWSNAHPDFCVSSQG
DSVYLNGDTSGLSLQLMPQTTPQKQYNNMFQTMLSGPTDVHGIIRNPHNFPTQQKSKLKR
VPSFRDYFRSSSSSSNINERPGSVPPQLSNGSTIYPETPKLMTNDEYMKSLPQLSPITAR
AITSPSRALSAVGVSKSSASNSISSLLANSGSASPMKPPDTPLPFTDSIKTLGQQNLTVA
VSNLNFSVGLVNCGNSCYMSCIIQCLLGTQELCTMFLNNSYQNHINLNSRLGSKGLLARY
FSQLIHQMYQYGKDIRKKMGNEKTAVIPTQFKIACGSINSSFKDNTQQDCQEFCQFLLDG
LHEDLNQCGNNPPLKELSEEAEKMREMMPMRLASAIEWERYLTTDFSVIVDLFQGQYASQ
LQCKVCQRTSTTYQPFSVLSVPVPSTRTCTLTDCFTEFTKIETLEQEEQWSCPSCKKRQP
STKKITITRLPRNLIIHLKRFDNMLNKNNVFVSYPSVLDLTAFWANDYDKKVTNNNVELP
SRGQVPPFNYQLYGIACHDGTLRAGHYTAYVNKGAVLGWCYYDDTNWRQIRSAREYITQN
AYVLFYHRIHST
NT seq 2559 nt NT seq  +upstreamnt  +downstreamnt
atgccgcatattcaggaaagcagggtctggtgcaggtccatcagccagctctcccatctc
gctgaacaatttgtcactgagaatggaactgaaagcacggacatgaaactgttgctccag
cagtgcgttgacacgttgtctaactatcaggatgagtgcaaaaagatcaaaagcgtgtcg
aagccggtgccctctaaggaactgtatgacttatacgaaacagcatatgtttacttcaag
atcgtatcgctgatcgtcttgaacaagatcccgaagctcgaggagtacgcgcgcgcgaag
agcgatgctgtagaccgcacgggcaagcagctgctagagatatacaacatgttggtgaac
cgcctagtcaaggatgatcggatcgcagagatcaagaggtttgtgaaggagaactcgcgg
cgggacccggaggcgaagaacgagcagatcggtgtggagagtggcaagagcattccggct
acgcttctccgcaacctgctcatgggcccatccgcctctggaactgtcttgcttgtggac
gttcggccccgccttgactttatgcgttgccatatcaaatcgtcgtctattatctgcata
gagcccgtctcgttcaaggaatcgtatacagatatcgatcttggaaagaaatcgatgatt
accagtcctgatgccgagatcgctttgtttcaggatcgcgacaagttcgactatattgtg
gtttacacgcaagacagtgaaaagaacaaacacaacgtgcagcagcagcaacttctagtt
gacttattgataaaccgttcctttgagaaggcgcttgacaggacgaaggtcttcattttg
gctggcgggttttctgagtggtctaatgcgcacccggacttctgtgtatcttcacaggga
gacagcgtttacctaaacggagatacctctggcctcagcttgcagttaatgccacagact
actcctcaaaaacagtataataatatgttccaaacgatgctatccggaccgactgacgta
cacggcataataaggaacccgcataattttcccacgcagcaaaaatcaaaactaaagaga
gttcctagctttagggattacttccgaagctcctcatcgtcgtctaatataaacgaaaga
cccggcagtgtccctccacagctttcaaatggttccacgatttaccctgaaacgcctaaa
ttgatgacaaatgatgagtatatgaaatctttaccgcaattatctccaattactgcacgg
gctataacttctccatcgagggctctttccgcggttggagtatcaaaatcttcagcttcg
aatagtatctcaagtcttttggcgaatagtggatcagccagcccaatgaagccaccagac
acaccgctacctttcacggattccataaagacccttgggcagcagaatcttacggtggcg
gtatcgaatctaaatttcagtgttgggttggtcaattgtggaaactcatgctatatgagt
tgcatcatccaatgtcttcttggaacgcaagaactatgcacgatgtttttgaataattca
tatcagaaccacattaatttgaacagcagactcggctctaaaggtttattggcaagatat
ttttcgcagctcattcaccaaatgtatcaatatggcaaggatatcaggaagaagatgggt
aacgagaagacggctgtaatcccaacacagttcaagattgcatgcggatctataaactcc
tcgttcaaagataacacacaacaggactgccaagaattttgccaattcctattggatggc
ctacatgaagacctaaaccaatgtggtaacaatcctcctttgaaagagctttcagaagag
gctgagaaaatgagggaaatgatgcccatgcgactggcttccgcaattgagtgggagcgt
tacttgacgacagatttcagtgtcattgtagatctcttccaaggccagtacgcgtctcag
ttgcaatgtaaagtgtgccagaggacctcaactacgtatcaaccgttttcagtcctttcc
gttccagtgcctagcacaaggacatgtacacttaccgactgtttcactgaatttaccaaa
atcgaaactttggagcaggaggagcagtggtcttgtccttcctgtaaaaaaagacaacct
tccactaaaaagatcaccattacgaggttacctcgtaatttaattattcatctcaaacgg
ttcgataatatgctaaacaaaaacaatgtttttgtatcctaccctagtgtactggacttg
actgcattctgggccaatgattatgacaaaaaagtcacgaacaataacgtagagctacct
tcgagagggcaagttccaccttttaactaccaactatacgggatagcttgccacgatgga
accctacgtgctggccactacacagcgtatgttaacaaaggagctgtacttggctggtgt
tactacgatgatacaaactggcggcaaatcagaagcgcaagggagtatattacccaaaac
gcatacgtattattttaccatcgtatacacagtacatga

DBGET integrated database retrieval system