KEGG   Ashbya gossypii (Eremothecium gossypii): AGOS_AFR019WHelp
Entry
AGOS_AFR019W      CDS       T00167                                 

Definition
(RefSeq) AFR019Wp
  KO
K04371  
mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
ago  Ashbya gossypii (Eremothecium gossypii)
Pathway
MAPK signaling pathway - yeast
AGE-RAGE signaling pathway in diabetic complications
Brite
KEGG Orthology (KO) [BR:ago00001]
 Environmental Information Processing
  Signal transduction
   04011 MAPK signaling pathway - yeast
    AGOS_AFR019W
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    AGOS_AFR019W
Enzymes [BR:ago01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     AGOS_AFR019W
Protein kinases [BR:ago01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   AGOS_AFR019W
Chromosome [BR:ago03036]
 Eukaryotic Type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     AGOS_AFR019W
Exosome [BR:ago04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   AGOS_AFR019W
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
VI:472913..473992
Genome map
AA seq 359 aa AA seqDB search
MGKKIVFNISSEFQLKALLGEGAYGIVCSAVHKPSGEVVAIKKIEPFERTLFSLRTLREI
KILKHFQHENIISIYDIQKPASFDTFNEVYIIQELMQTDLHRVIATQPLSDDHIQYFIYQ
TLRGLKALHGSGIIHRDLKPSNLLLNANCDLKICDFGLARIEHGGAADLEHPQAGMTEYV
ATRWYRAPEVMLTAAQYTKAIDIWSSGCILAELFMKRPLFAGKDYKHQLMLIFELLGTPQ
GDDLAAVKSRRAREYIATLPRYRRASLRAVIPHANPLGLDLLQRMLVFDPRRRITAADAL
RHPYLATYHDPRDEPDGTPIPASFFDFDHHKDKLTTRDLKRMLWDEVFRDTHAPVRPDA
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgggcaagaagatcgtgttcaacatcagctcggagttccagctgaaggcgctgctcggc
gagggcgcgtacgggatcgtgtgctcggccgtgcacaagcccagcggggaggtggtcgcg
atcaagaagatcgagccgttcgaacgcacgctgttctcgctgcgcacgctgcgcgagatc
aagattctcaagcacttccagcacgagaacatcattagcatatacgacatccagaagccc
gcgtcgttcgacacgtttaacgaggtgtacatcatccaggagctgatgcagacggacctg
caccgcgtgatcgcgacgcagccgctctcggacgaccacatccagtacttcatctaccag
acgctgcgcgggctcaaggcgctgcacggcagcggcatcatccaccgcgacctcaagccg
tccaacctgctgctcaacgcgaactgcgacctcaagatctgcgacttcgggctcgcgcgc
atcgagcacggcggtgccgccgacctcgagcacccgcaggccggcatgaccgagtacgtc
gccacgcgctggtaccgcgcgccggaggtcatgctcactgccgcccagtacaccaaggcc
atcgacatatggtcgtccggctgcatcctcgccgagctcttcatgaagcgcccgctgttc
gccggcaaggactacaagcaccagctcatgctgatcttcgagctgctcggcaccccgcag
ggcgacgacctggctgccgtcaagtcccgccgcgcccgcgaatatatagccacgctgccg
cgctaccgccgcgccagcctgcgcgccgtcatcccgcacgcgaacccgctgggcctggac
ctgctgcagcgcatgctggtcttcgacccgcgccgcaggatcaccgccgccgacgccctg
cggcacccgtacctggccacgtaccacgacccccgcgacgagcccgacggaacacccatt
cccgcgtcctttttcgacttcgatcaccacaaagacaagctcaccactcgtgatctcaag
cgcatgctgtgggacgaggtcttccgcgatactcatgcgccggtccgcccggacgcgtag

DBGET integrated database retrieval system