KEGG   Ashbya gossypii (Eremothecium gossypii): AGOS_AFR166CHelp
Entry
AGOS_AFR166C      CDS       T00167                                 

Definition
AFR166Cp
Orthology
K06269  
serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
ago  Ashbya gossypii (Eremothecium gossypii)
Pathway
mRNA surveillance pathway
Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:ago00001]
 Genetic Information Processing
  Translation
   03015 mRNA surveillance pathway
    AGOS_AFR166C
 Cellular Processes
  Cell growth and death
   04113 Meiosis - yeast
    AGOS_AFR166C
Enzymes [BR:ago01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     AGOS_AFR166C
Protein phosphatases and associated proteins [BR:ago01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    Catalytic subunits
     AGOS_AFR166C
Transcription machinery [BR:ago03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription termination factor
     AGOS_AFR166C
Spliceosome [BR:ago03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    AGOS_AFR166C
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
VI:complement(join(737857..738618,738819..739001))
Genome map
AA seq 314 aa AA seqDB search
MSMETPPVDIDNIIDRLLEVRGSKPGQQVDLEEHEIRYLCSKARSIFIKQPILLELEAPI
KICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFF
ILRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIIDEKIFCMHGGLSPD
LNTMEQIRRVMRPTDIPDVGLLCDLLWSDPDKDIVGWSENDRGVSFTFGPDVVSRFLQKQ
DMELICRAHQVVEDGYEFFSKRQLVTLFSAPNYCGEFDNAGAMMSVDESLLCSFQILKPA
VKPSAGRGQPKKKK
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgagcatggaaacgccccctgtagatatcgacaacatcatcgaccgcttgctggaggtg
cggggctcgaagccggggcagcaggtggacctcgaagagcacgagatccgctacctgtgc
tccaaggcgcgcagcatctttatcaagcagcccattcttcttgagctggaggctccgatc
aagatatgcggcgacatccatgggcagtattacgacctcctgcggcttttcgagtacggc
gggtttccgccggagtccaactacctgtttctgggggactacgtggaccgcgggaagcag
tcgctggagaccatctgcctgcttctggcgtacaaaataaagtatccggaaaacttcttt
attctgcgcggaaaccacgagtgcgcgtcgatcaaccggatatacgggttttacgacgag
tgcaagcggcggtacaacatcaagctgtggaagacgttcacggactgcttcaactgcctg
ccaattgcggcgatcatcgacgagaagatattctgtatgcacggcgggctgtcgccggac
ctgaacacgatggagcagattcggcgggtgatgcggccgacggacatcccggacgtgggc
ctgttgtgcgacctattgtggtcggaccccgacaaggacatcgtggggtggtctgagaat
gatagaggcgtttcgtttacatttgggccggacgtggtgtcgcggttcctgcagaagcag
gatatggagctcatttgccgggctcaccaggtggtcgaggacggctacgagtttttctct
aagcgacagttggtgacgctattcagcgcgcccaactactgcggggagttcgacaacgcc
ggtgcgatgatgagtgtggacgagagtttgttgtgttccttccagattttgaagccggcg
gtcaagcccagtgcagggcgcggccagcctaagaagaagaaatga

DBGET integrated database retrieval system