KEGG   Ashbya gossypii (Eremothecium gossypii): AGOS_AFR221CHelp
Entry
AGOS_AFR221C      CDS       T00167                                 

Definition
AFR221Cp
Orthology
K11401  
histone acetyltransferase SAS2 [EC:2.3.1.48]
Organism
ago  Ashbya gossypii (Eremothecium gossypii)
Brite
Enzymes [BR:ago01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     AGOS_AFR221C
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
VI:complement(834993..835937)
Genome map
AA seq 314 aa AA seqDB search
MKSSSSPSDEGDLYGILDKPNIKQVQFGLGKRFKTWYGSAVYFARDKRTLGYKAKNVGMC
DRSMDESTEGGFWLDELFVCEYCFKYYDRPDELVGHVKSCRYKLRLPGRIKYMSPEYTIR
KVKGKKHELFCQCMCLFTKLFLDNKSVYFRMTSYEFYILYNTEGREPLGFFSKDLYSYNR
NNLACILVFPPYQRRNLGTLLIDFSYRLSRNEGIVSGPEFPLSPFGLIGYLKYWSFAIVW
HLTEGELSNLHKVSLNVISEVTGIRVSDVIITLKHLQCLTENNEILLPVIRRWAKELKVD
RGFMIQEQYLLLND
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgaagtcatcaagtagtcccagtgatgaaggcgacctatatggcattttggacaagccc
aatatcaagcaggtgcaattcgggctaggtaaacggttcaagacatggtatggaagcgcg
gtatactttgcacgggacaagcgaaccctaggttacaaggccaaaaatgtgggaatgtgc
gaccggtctatggatgagagtacagaaggagggttctggctcgatgaactatttgtttgc
gagtattgcttcaagtactacgatcggccagatgagttggttgggcatgtgaagagctgc
cggtacaagcttcgactaccaggtcgaatcaaatacatgagccctgagtataccattcgg
aaggttaaaggaaagaagcacgagctgttctgccagtgcatgtgcttattcacgaaatta
tttctcgataacaagtccgtgtacttcagaatgaccagctatgagttctatatcctatac
aatactgagggccgcgagcctctgggctttttttccaaagacttgtattcatacaatcgg
aataatttggcttgcattctggtatttcctccttaccagcggcgaaaccttggaactttg
ctgatagatttttcgtaccggctatcgagaaatgaaggcatagtatcagggcctgaattt
ccattgtcaccttttggattgattgggtatctaaagtactggtcatttgctatagtatgg
catctaaccgagggtgaactgtctaacttgcacaaagttagtttaaacgtcatctctgaa
gtaactggtatccgggtctccgacgtgatcataacattgaagcatctacaatgtctcaca
gaaaataacgaaattctgctccccgttattagaaggtgggcgaaggagctgaaagttgac
agggggtttatgatacaagaacaatatctcttattgaacgattaa

DBGET integrated database retrieval system