KEGG   Ashbya gossypii (Eremothecium gossypii): AGOS_AFR303WHelp
Entry
AGOS_AFR303W      CDS       T00167                                 

Definition
AFR303Wp
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
ago  Ashbya gossypii (Eremothecium gossypii)
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ago00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    AGOS_AFR303W
Enzymes [BR:ago01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     AGOS_AFR303W
Peptidases [BR:ago01002]
 Cysteine Peptidases
  Family C44
   AGOS_AFR303W
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
VI:990504..992219
Genome map
AA seq 571 aa AA seqDB search
MCGIFACYRKDDIESFKPTALRLSKRVRHRGPDWSGNVIKNDTILVHERLAIVGLDSGAQ
PINSPDGNYVLCVNGEIYNHIHLREECSDYEFTSLSDCEPIIPLYLKYDVETPQHLDGMF
AWCLYDVQRDRIVAARDPIGVTTLYMGKSSSSPRTRYFASELKCLVDECDEITAFPPGHV
YDSDTDKLTRYFKPDWIDETRIPSQPVDYKAVRTTLEKAVRKRLMAEVPYGVLLSGGLDS
SLIASIAARETERANREAGDVYADGKHLAGMDDRGLLHTGGWSRLHSFAIGLPNAPDLQA
ARKVAKFIGSIHHEHTFTLQEGLDALDDVIHHLETYDVTTIRASTPMFLLSRKIKAQGVK
MVLSGEGSDEIFGGYLYFAQAPSPAEFHTETVKRVNNLHLADCLRANKSTMAWGLEARVP
FLDREFLQLCMNIDPAEKMIAPQKGRIEKYILRKAFDTSDEPGVDPYLPEEILWRQKEQF
SDGVGYSWIDGLKDAAERAISDEQFANPNPAWGDDIPTTKEAFWYRLKFDALFPQPTAAA
TVMRWVPKADWGCAEDPSGRYAKIHDQHISS
NT seq 1716 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggcatttttgcgtgttatagaaaagatgacatcgagtcatttaagcccaccgca
ctacggctatctaagcgggtgaggcatcgcggcccggactggtcgggcaacgtaattaag
aatgacacgatcttggtccatgaacgtctagccattgtcggacttgactcgggtgctcag
cccatcaattcgccagatggaaactatgttctatgcgtcaacggcgagatctacaaccac
atccacctacgcgaggagtgctccgattacgaattcacttccctctccgattgtgagcct
attatcccactgtatctcaagtatgacgtggagacgccgcagcatttggacgggatgttt
gcgtggtgtctgtacgatgtgcagcgcgaccgtatcgtagctgctcgtgacccaatcggg
gtgacaactctttacatgggtaagtcttcatcctcgcctcggacacggtattttgcctct
gaactgaagtgtcttgtagacgagtgtgacgagatcacggccttcccgcccggtcacgtg
tatgactctgacactgacaagctgactcgttatttcaagcccgattggatagatgagacg
cgtattccatcccagccagtagactataaggccgtgcgtactacattggagaaggcagtg
cgcaagcggttgatggcggaggtgccttacggtgttctgttgtcgggcgggcttgactca
tcgttgattgcgtcgatcgccgcgcgtgagactgaaagagctaaccgcgaggcgggtgat
gtgtatgcagatgggaaacacctagcggggatggacgaccgcgggcttctacacacgggt
ggctggtcgcgcctgcactcgtttgcgattgggttgccaaatgctccagacctacaggct
gctcggaaggttgccaagttcatcggttcgatccaccacgagcacactttcacactgcaa
gaagggctggatgccctagacgatgtgatccaccatttggagacatacgacgtgactact
atccgtgcgtcgacaccgatgttcttgctatctcggaaaatcaaggcacagggcgtcaag
atggtgctgtcgggcgagggctctgacgaaatatttggtggttacctgtactttgcgcag
gcgccatcgccagcggagttccacaccgagactgtcaagcgtgtgaacaacttgcacctg
gcggactgtttgcgcgccaataagtccactatggcatgggggctagaagcacgtgtgcca
ttcctagaccgcgaattcctccagctctgcatgaacatcgatcccgcggagaagatgatc
gctccgcaaaagggccgcattgagaagtacatcctacgtaaggcttttgacacttccgac
gagcctggagttgacccatatttgcccgaggagatactatggcgccagaaggagcagttc
tcggatggcgtcggctactcatggatcgacggcctcaaggacgccgccgagcgcgccata
tcagacgagcagtttgcgaacccgaaccccgcgtggggtgacgatattccaacaacgaag
gaggcattctggtacaggctcaagtttgatgctctgttcccacagccgacagccgccgca
accgtgatgagatgggtgccaaaggccgactggggctgcgccgaggatccatctggcaga
tatgcgaagatccacgaccagcatatttcctcataa

DBGET integrated database retrieval system