KEGG   Ashbya gossypii (Eremothecium gossypii): AGOS_AFR360WHelp
Entry
AGOS_AFR360W      CDS       T00167                                 

Definition
AFR360Wp
Orthology
K08738  
cytochrome c
Organism
ago  Ashbya gossypii (Eremothecium gossypii)
Pathway
Sulfur metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ago00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    AGOS_AFR360W
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
VI:1091645..1092112
Genome map
AA seq 155 aa AA seqDB search
MTDVSGCFSCPAHLYKTHRFAAVVEHLSYFVCSQQTTAKQSHIVIMPAPYKPGSEKKGAT
LFKTRCLQCHTTEKGGPHKVGPNLHGVFSRQSGQVSGYSYTDAMINRNVTWDAQSMSDYL
ENPKKYIPGTKMAFGGLKKEKDRNDLITYMLKACK
NT seq 468 nt NT seq  +upstreamnt  +downstreamnt
atgaccgatgtatccggatgcttcagctgcccagcccatctatataagacgcatagattt
gccgcagttgtggaacacctgagttatttcgtttgcagtcaacagacaaccgcaaaacag
tcacacatagttatcatgccagccccatacaagccaggttccgagaagaagggtgctact
ttgttcaagactagatgtctacagtgccacaccaccgagaagggcggtccacacaaggtt
ggtcctaacttacacggtgtcttcagcagacagtccggtcaggtctccggttactcttac
accgacgcgatgatcaaccgcaacgttacgtgggacgcccagtcgatgtccgactacttg
gagaacccaaagaagtacattccaggtaccaagatggcctttggtgggttgaaaaaggag
aaggacagaaacgacttgatcacctacatgttgaaggcttgtaaataa

DBGET integrated database retrieval system