KEGG   Ashbya gossypii (Eremothecium gossypii): AGOS_AFR360WHelp
Entry
AGOS_AFR360W      CDS       T00167                                 

Definition
(RefSeq) AFR360Wp
  KO
K08738  cytochrome c
Organism
ago  Ashbya gossypii (Eremothecium gossypii)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3
Motif
Other DBs
NCBI-GeneID: 4622177
NCBI-ProteinID: NP_985907
UniProt: Q753F4
Position
VI:1091645..1092112
Genome map
AA seq 155 aa AA seqDB search
MTDVSGCFSCPAHLYKTHRFAAVVEHLSYFVCSQQTTAKQSHIVIMPAPYKPGSEKKGAT
LFKTRCLQCHTTEKGGPHKVGPNLHGVFSRQSGQVSGYSYTDAMINRNVTWDAQSMSDYL
ENPKKYIPGTKMAFGGLKKEKDRNDLITYMLKACK
NT seq 468 nt NT seq  +upstreamnt  +downstreamnt
atgaccgatgtatccggatgcttcagctgcccagcccatctatataagacgcatagattt
gccgcagttgtggaacacctgagttatttcgtttgcagtcaacagacaaccgcaaaacag
tcacacatagttatcatgccagccccatacaagccaggttccgagaagaagggtgctact
ttgttcaagactagatgtctacagtgccacaccaccgagaagggcggtccacacaaggtt
ggtcctaacttacacggtgtcttcagcagacagtccggtcaggtctccggttactcttac
accgacgcgatgatcaaccgcaacgttacgtgggacgcccagtcgatgtccgactacttg
gagaacccaaagaagtacattccaggtaccaagatggcctttggtgggttgaaaaaggag
aaggacagaaacgacttgatcacctacatgttgaaggcttgtaaataa

DBGET integrated database retrieval system