KEGG   Ashbya gossypii (Eremothecium gossypii): AGOS_AFR400CHelp
Entry
AGOS_AFR400C      CDS       T00167                                 

Definition
AFR400Cp
Orthology
K00493  
unspecific monooxygenase [EC:1.14.14.1]
Organism
ago  Ashbya gossypii (Eremothecium gossypii)
Pathway
Fatty acid degradation
Tryptophan metabolism
Brite
KEGG Orthology (KO) [BR:ago00001]
 Metabolism
  Lipid metabolism
   00071 Fatty acid degradation
    AGOS_AFR400C
  Amino acid metabolism
   00380 Tryptophan metabolism
    AGOS_AFR400C
Enzymes [BR:ago01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     AGOS_AFR400C
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
VI:complement(1158142..1159626)
Genome map
AA seq 494 aa AA seqDB search
MTANIVLVLLGGLVLNYIRSIVLPPWGFPRNIPTIPFYVTFLTTLFDIDQKELFELYIRK
PMEKYGAVKIYFGNRWNILVSKPEFLAQMFKDEDTFAKSGNHIKIPYSILALYTGDNVIS
SHGLAWKKFRGALTQGLQFFDPSPLSANAEKFIGFIERDMKKNNGEVLMPALIQRLALAN
IAQIALGFDIGTLDPERPSKLQQQLEEVKKHIFHPLYMNFSFLDRLPIPSRIRARQQVER
FRSDLLQEVRRNLIINYKYEQTSYAASDLIRVYEHGEITEKQLTDNIVILMVAGHENPQL
LLTTCLYMLAKYPEWQARLRQQAVTLQDDLLNDSVEFNQFLFETVRVLPPLGQIINRKTS
HKCKLGPEIVLPKDTYVGYQVYGTGTSTQVWGPDAAEFKPERWGSTNATVHETWRRSKNT
GAMGAFHGGRRACLGEKMGLMETRVALAHMLRKLEWTLSPNWKDRVTPAGPLCPFMLKLQ
FTRIQEPLAAELTA
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgacagcgaatattgttctggtgctattaggagggcttgttttgaattacattagatca
atagtgcttccaccatggggcttcccgagaaatattcctacaattccgttctatgtcacc
ttcttgaccactctattcgacatagatcagaaagaattatttgaactttacatcagaaaa
ccaatggagaaatatggagctgtaaagatatatttcggtaaccgatggaatattttggtg
tccaagccagaatttttggcccaaatgttcaaagatgaggacacatttgcaaaaagtggg
aatcatatcaaaataccatattccatccttgctttatacacaggagataacgttattagt
tcacatggacttgcttggaaaaagtttcgcggagcattgacccaagggttgcagtttttc
gatccatcaccgctatccgccaatgcggagaagttcatcggtttcatagagcgcgacatg
aagaaaaataatggcgaggtcctcatgccagcgctgattcaaagattagctttagcaaac
attgctcaaatagcactgggatttgatatcggtactctggaccctgaacgcccttcgaag
ctacaacaacagctagaggaagtaaagaaacatatattccatccactgtatatgaatttc
tcctttcttgacaggctaccaataccttctcgtataagagctagacagcaagtcgaaagg
ttccgcagcgatctattacaggaggtcaggagaaatctaataataaactacaagtacgaa
caaacttcgtatgctgcttccgacttgatcagagtctatgaacatggcgaaatcacagaa
aaacaattgacagataatatagttatcctcatggtagcaggacatgaaaatccacagcta
ttactaacaacctgtttgtacatgctagcgaaatacccagagtggcaagctagattacgt
cagcaggcggtgacgctccaggacgatttgctcaatgactccgtggaatttaaccagttt
ttattcgaaaccgtaagagtgctacctccactagggcaaatcattaaccggaagacaagc
cacaagtgcaaattgggccctgaaatcgtacttccaaaagatacctacgtgggttaccag
gtctatgggactggtacatctacgcaagtctgggggcctgacgccgccgagtttaagcca
gaaagatggggctccacgaatgccactgtacatgaaacctggaggcgcagtaaaaacact
ggcgctatgggggctttccacggtggtcggcgggcatgcctgggcgagaagatgggcttg
atggagacgagagtggccctcgcgcatatgctacgcaaactggagtggacactcagcccc
aactggaaagatagagtgacgccagcaggccctctgtgtcctttcatgctaaagctgcaa
ttcactcgcattcaggagccgctggcggcagagcttactgcataa

DBGET integrated database retrieval system