KEGG   Ashbya gossypii (Eremothecium gossypii): AGOS_AFR420WHelp
Entry
AGOS_AFR420W      CDS       T00167                                 

Definition
AFR420Wp
Orthology
K07203  
FKBP12-rapamycin complex-associated protein
Organism
ago  Ashbya gossypii (Eremothecium gossypii)
Brite
Protein kinases [BR:ago01001]
 Serine/threonine protein kinases: Atypical group
  PIKK family [OT]
   AGOS_AFR420W
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
VI:1190365..1197753
Genome map
AA seq 2462 aa AA seqDB search
MTMLKRKGDKAKKRLVSITTSSDDLFVDSASAAGTAGASSAAVGNGGPGAFVKAAATPGV
VDSDSETSFSGFTAIFNRLKSSHNQERKAASFELKNSLISLAREVSTEHFQRFSNELNNK
IFELIHGSDSNEKLGGVLAVNTLIDFYAHTDELPNQTSRLANYLRVLIPSNDIEVMRAAA
AALGKLAMPGGTLTSDFVEFEVKTCIEWLTTSPENSSSNSKQEYRKHASLLIITAIADNS
PYLLYPYLNSVLDNIWRALRDTKLVIRIDAAITLRHCLSIINDRDSVLTNRWVQRLFKSC
AYGLNLGTLEAVHGTLLVYRELMSLKGPYLYEKFNEIYETTMRYKDHKSPVIRKEIYAIL
PLLASFDSDLFTEEYLDDTMVHYLTLLKNVHSGVANSPDRAAILVSIGDIAFQVRSNIAA
YLDSILDNIRDGFLTKHKSRKHFESELFYCIAKLACAVGPILSKYLHSDLLDLMLACPLS
DYMQDTLETLNQELPALEPLVNEKLLDLICYNLSGDKFRPPGSPTPIKHFSNEKARAYRD
QSWLRKTGDINDSNQDALILTQALRMLATINHKYSLAEFVRLVVISYIEHENPQVRKLAA
LTSCDLFVKENVCQQTSLHALNAVAEVLSKLLTVAITDPVAEIRHEILKHLDSSFDPQLS
QPDNARLLFMALNDEVFIIQMQAMKIVGRLASVNPAYIVPSLRKTLIQLLTELKHSSMTR
KKEESASMFCTLISSSKDVTRPYIESILDVLLPKCQDSSSAVASTALQAVGELSVVGGEN
MKDYLDKLMPLIINTFQDQSNSFKRSAALKTLGQLSASSGYVIDPLLDYPQLLGVLVNIL
KAESSQSIRRETVRLIGILGALDPYKHREVERTSSTPISVEQNAPSIDVALLMQGMSPSN
EEYYPTVVINTLMKILKDPSLSSHHTAVIQAVMHIFQTLGLRCVSFLKQIIPGMINVMRS
CPPSILEFYFQQLGVMVSIVKQHIRPYVDEIFEVIKEFFPFIKLQITIISVIESISKSLE
GEFKPYLPTTLTLFLDVLEKDNSNKKIISIRILKSLVVFGPNLDDYIHLVIPSIVRMCEY
GSGNLNRAAIVTIGRLAKSVNLSEMSSRIVQTMIRVLNVSDQQIIRAVMNTLSLLLLQLS
TDFTVFIPIINKTLVKAHIQHSIYDQLVGKLMNNEPLPTKVVVDKDFEVPSREVSDTEVP
SRKLPVNQAVLKSAWDCSQQRTKEDWQEWMRRLSIQLLKESPSHALRACSGLAGIYYPLA
RELFNASFASCWTELYTQYQEDLVKSLCSALSSPNNPPEIHQTLLNLVEFLEHDDKSLPI
SIPTLGEYAQRCHAYAKALHYKELEFIQEPSTSTIESLISINNQLHQTDAAIGILKHAQQ
HHDLQLKETWYEKLQRWDDALNAYNQREAAGEDTIEVTMGKMRSLHALGEWEQLSQLGAE
KWANAKLDIKRIIAPLAAAAEWGLGHWDSIEKYINVMKPQSPDKEFFDAILCLHSNDFEK
ASEHIFLARDLLVTEMSALVNESYNRAYSVVVRSQMIAELEEIIQYKKLPQNSEKRAIMR
KTWNHRLLGCQKNVDVWQRILRVRSLVVKPKQDMQVWIKFANLCRKSGRMGLAQKALNSL
LEEGGDPEHPNTARAPPPVVYAQLKYMWATGSRKDALRHLISFTSRMAHDLGLDPSNMIA
QNVPHNSVVPACHIEEYTKLLARCFLKQGEWRVMLQPKWRTDTPDAILGSYLLATHFDNT
WYKAWHNWALANFEVISLMTDSVRDEHRALSNETESVGQTDGTAQHNSIDVDAVNCNGSE
CHPDLVQRHVVPAIKGFFHSISLSESNSLQDTLRLLTLWFTFGGIPEAAQAMHEGFNLIK
IDNWLEVIPQLISRIHQPNQTVSRSLLSLLSDLGKAHPQALVFPLTVAIKSESVSRQRAA
LSIMEKMRMHSSNLVEQAELVSNELIRIAVLWHELWYEGLEDASRQFFGEHNTEKMFATL
EPLHEMLKRGPETLREISFQNSFGRDLNDAYEWVMNYKRTQDISNLDQAWDIYYNVFRRI
SRQLPQLQTLDLQHVSPKLLAANDLELAVPGTYSTGKPVVRISYFEPVFSVISSKQRPRR
LSIKGSDGKDYQYALKGHEDIRQDSLVMQLFGLVNTLLQNDSECFRRHLDIQKYPAIPLS
PKSGLLGWVPNSDTFHVLIRGYRESRKIQLNLEHRIMLQMAPDYDNLTLLQKVEVFTYAL
DNTKGQDLYKVLWLKSRSSESWLERRTTYTRSLAVMSMVGYILGLGDRHPSNLMLDRITG
KVVHIDFGDCFEAAILREKYPEKVPFRLTRMLTYAMEVSGIEGSFRITCENVMKVLRDNK
ESLMAILEAFAHDPLINWGFDLPTQAITEQTGIQLPVTNPSELLRNGVITAEEAARMEVQ
QRAEIRNARATLVLKRITDKLTGNDFRGFRDLDVPEQVDKLIQQATSVENLCQHYIGWCS
FW
NT seq 7389 nt NT seq  +upstreamnt  +downstreamnt
atgaccatgctaaagcggaagggagataaggccaagaaaagacttgtttcgatcacgact
tcgtcagatgatttgtttgttgactctgcgtctgctgcgggcacagcgggagcgtcttca
gcggccgtgggtaacggcgggccgggcgcgtttgtgaaggcggccgcgacacccggggtg
gtggactcggactcggaaacgagcttctcgggattcactgcgatctttaacaggctaaag
agcagccataaccaagagcgaaaagcggcgtcttttgagctgaagaatagtctcatttcg
ctagccagggaggtgtctactgagcactttcagcggttcagcaacgagctgaacaacaag
atcttcgagctgatccacggctcggactcgaacgagaaactgggaggcgtgctggcggtg
aacacgctgatagacttttatgcacacacagacgaactacccaaccagacgtcgcgtctg
gcgaactatctgcgcgtgctgataccgtcgaatgacatcgaggttatgcgcgctgcggcc
gccgcgcttgggaagctggccatgccgggaggaacgctgacgtctgactttgttgagttc
gaagtaaagacgtgcatcgaatggctcaccacttcaccagaaaactcatcctcaaactcg
aagcaggagtacaggaagcacgcttcactactgataatcacggctatcgccgacaactcg
ccatatctgctgtatccatacttgaattctgttctcgacaatatatggcgcgctttacgg
gacaccaagttggtaatacgaatcgatgcggcaattaccttgcgccactgtttgtctatt
atcaacgaccgggactccgtcctaacgaacaggtgggtgcagcgattgtttaaaagctgc
gcctacgggcttaaccttgggacgctagaggcagtccatgggacgcttttggtctatcgg
gagctgatgtcactgaaggggccatatctgtatgaaaaattcaatgaaatctacgagacc
actatgagatacaaagatcataaatcacctgtgatacgaaaagaaatatacgcgatattg
ccgctgcttgcatcctttgattctgatttgtttacggaggaataccttgacgacaccatg
gtacactatctgacattgttgaagaacgtgcactctggggttgctaatagtcctgacaga
gcggctatccttgtatcgattggtgatattgctttccaagtgcgttctaatatagcggcc
tacttggactcaattctggacaatatcagggatggatttctcaccaagcataagagtcgc
aagcattttgagagcgaattgttctactgtattgccaaactggcatgcgccgttggtcct
attctctcgaaatatctgcatagtgacttgttagatttgatgctggcctgtccattgagc
gattatatgcaggatactctcgaaacattaaaccaggaactacccgcactggagccactg
gtcaatgagaagctattggatctaatatgttataatctttctggtgataaatttcggccg
cctggctcgccaacacccattaagcatttttctaatgagaaagcgagggcataccgagat
caatcatggctacggaaaacaggtgatataaacgatagcaaccaggatgcacttatcctc
acccaagctttgcggatgctcgcgaccatcaatcacaaatactcactagctgaatttgtt
aggctagttgttatctcatatattgaacacgaaaaccctcaagtgaggaaactggccgcc
ctaacctcctgtgatttatttgtaaaggaaaatgtttgccagcaaacatctctacatgcc
ttaaatgcggttgctgaggttttgagtaaactgctgactgtcgcgataacagacccggtg
gcagaaatcaggcatgagattctaaagcatttagacagcagtttcgatccgcagttatcc
caaccagataatgctcggttattgttcatggccctcaatgatgaagtttttatcatacag
atgcaagctatgaaaattgttggtagacttgcatcagttaatcctgcgtatattgtccct
tcactccgaaaaactcttatccagctacttacagagctaaagcactcaagcatgacacgc
aagaaagaagaaagtgcatcaatgttctgtactctaatcagttcgagtaaagatgtgacg
cgaccttatattgagtctattttggatgttctcctgccaaaatgccaggatagttcctct
gcagtggcctccaccgcactacaagctgttggggaactctctgttgttggtggcgaaaac
atgaaagattatttagataaactaatgccgctgattattaacactttccaggaccagtca
aactcttttaagcgaagcgcagctctgaaaactctgggccaactatccgcatcctcagga
tacgttatcgatcctttacttgactatcctcaattacttggtgttctcgtgaatatttta
aaagcggagagttcccaaagcataaggagggaaacagttagactaatagggattctggga
gctctggacccttataaacatagagaagttgaaagaacatccagcacgcctatatccgtc
gaacaaaatgccccatccatagatgttgctttgttaatgcaaggtatgtcaccctccaat
gaagaatattatccaaccgtcgtgatcaatactctaatgaaaattttgaaggatccttct
ttatcttctcatcacactgctgtcatacaggcagtgatgcacatcttccaaacattggga
ctccgctgcgtctccttcctaaagcaaattattccaggaatgattaatgtgatgcgtagc
tgtcctccatcaatacttgagttttattttcaacaattaggtgttatggtatcaattgtg
aagcaacatatcaggccatatgttgacgaaatatttgaagtcattaaagagttcttccca
tttattaaactgcaaattacaatcatttctgttatcgaatctatttctaaatctttggaa
ggagagtttaagccatatctgcccaccactctgacactcttcttggatgttctggagaaa
gataattcaaataaaaaaataatttccatacggatcctcaaatcattggtggtttttggg
ccaaacttagatgactatatccatctagtcatcccgtcaattgtcagaatgtgtgaatat
ggcagtggaaatctaaacagagcagcaatcgttaccattggaagactggctaagagtgtg
aacctctctgagatgtcctcaagaattgtgcaaaccatgattcgcgtgctaaatgtatcc
gatcagcaaattatcagagcagtaatgaatactctaagtttgcttctcctgcagctaagc
actgatttcactgtttttattcctattattaacaagacccttgttaaagcgcatattcag
cacagcatatatgaccagctggttggtaaactgatgaacaacgaacctttacctaccaaa
gtggttgttgacaaggactttgaagtcccaagtcgggaagtgtcagatacggaggtcccg
tcaaggaagctccctgtgaaccaagccgtgctcaaaagtgcatgggattgtagccagcaa
agaacaaaagaagactggcaagaatggatgcgcaggttgtctatacagctattgaaggaa
tcaccatctcatgctcttcgcgcatgttccggcttagcgggcatttactatcctttggca
cgtgaactttttaacgcctcttttgcaagttgttggactgagctttacacgcagtatcag
gaggatcttgtcaagtccctgtgctctgcgctttcatcgccaaataatccaccagagata
catcagacgcttttgaatctcgttgaatttttggaacatgatgataaatcgcttccaatt
tcaattcctacgttgggtgaatatgctcagagatgtcatgcctatgcaaaagcattacac
tataaagagttagagttcattcaagaaccgagcacgtccactattgaatcactaataagt
atcaataatcaactccaccaaacagacgctgctattggaatcttaaagcacgcgcaacag
catcatgacttgcaattgaaagagacatggtatgaaaagttacagagatgggatgacgct
ttgaacgcgtataatcagcgggaagctgctggtgaggataccatagaagtaacgatgggt
aaaatgaggtcgttacatgctcttggagagtgggaacagttatctcagctaggcgcagaa
aaatgggccaatgcaaagttagacataaagcgtataattgctcctctcgctgctgctgct
gaatggggactagggcattgggattctattgagaaatatatcaatgtgatgaagccacaa
tcgcctgataaagagttctttgatgcaatactttgtcttcacagcaacgattttgaaaaa
gcatctgagcacatattccttgccagagatttactagtgacggaaatgtctgcactggtt
aatgaaagttataatagggcatatagcgtcgtcgtgcggtcacagatgatagcagagttg
gaagagatcattcaatataagaaattgccccaaaattctgagaagcgtgcaattatgaga
aaaacttggaaccacagacttctaggatgtcaaaagaacgttgacgtatggcagcgcata
cttagagtcaggtctctggttgtgaagccaaagcaggatatgcaggtgtggattaaattt
gcgaacttatgtcgtaaatctggaaggatggggctggcccaaaaagcattgaattcgttg
ctagaggaaggtggcgaccctgaacatccaaacactgcaagagctccgccacctgttgtt
tatgctcaactgaaatatatgtgggcaactggctctcgaaaggatgctctgcgccatctc
attagcttcacatcgaggatggcacatgatttgggcctggatccaagtaatatgattgcg
caaaatgttcctcacaacagtgttgttcctgcatgccacattgaagagtacaccaaatta
ctggcgcgctgtttcttaaagcagggagaatggagagttatgctgcaacctaaatggagg
actgatacccctgatgccattctcggttcctacctattggccactcattttgataatact
tggtataaggcttggcataattgggcgttggcaaactttgaggtcatatcgttgatgaca
gatagtgtccgtgatgagcatcgcgcattatcgaatgaaacggaatccgtgggccagact
gatggcaccgcccagcataatagtattgacgttgacgctgtaaattgcaatggttcggaa
tgtcatccagatcttgttcagaggcacgttgttcccgcaattaagggcttcttccattcg
atatctctgtcggaatctaactctctgcaggatactttacgcttgctgacattatggttt
acttttggtgggattccagaagccgctcaggccatgcatgaaggttttaatttaattaaa
attgacaactggctagaagtgataccgcagttgatatcccgaattcaccagcctaaccaa
accgtgagtagatcattattatctctcttatctgacctcggcaaggctcatcctcaggct
ctcgtcttccctctaacagttgctataaaatctgaatctgtatctaggcagagagctgct
ttgtctattatggagaagatgcgtatgcatagttctaatctggttgaacaggcagaactg
gttagcaatgagctcattcgtattgctgtgctgtggcatgagctatggtatgaaggtctg
gaggacgcgagtagacagtttttcggagagcataatacggaaaagatgttcgctactttg
gaaccactgcatgaaatgttgaagaggggacctgagactctacgggagatatcattccag
aattcatttggtagagacctgaatgacgcatatgaatgggtcatgaactataagaggaca
caggatatcagtaatttggatcaggcctgggacatatattacaatgttttccggcgcatt
agcagacaactcccccagctacaaactttggatttgcagcatgtatcaccgaagctattg
gcagcgaacgacttggaactggctgtcccgggtacctacagtacaggaaaaccagttgtt
cgtatctcgtactttgaacctgtcttttcagtcatttcctcgaagcagcgcccacgccgt
ctgtccataaagggtagtgatggtaaggattaccagtacgcattgaagggtcatgaagat
attagacaagatagtctcgtgatgcaactattcggtttggtaaacactctacttcaaaat
gattctgaatgtttccgtagacatttagatatccaaaagtatcccgctatcccattgtct
ccaaaatctggtttacttggatgggttccgaatagtgataccttccacgttctcatcagg
ggataccgcgaatcgaggaaaattcagctgaacctagagcacaggattatgttgcagatg
gcacccgactatgataatttgacattactacagaaagtagaggtctttacttatgccttg
gacaatacgaaaggacaagacctatataaggttctctggttgaagagtcggtcttctgag
tcatggctggagagaagaaccacttacacccgttccttggccgtgatgtccatggtcggc
tatatactggggctcggagaccgtcacccaagcaatctgatgctggaccgcattactggc
aaggtggtacacatcgatttcggtgactgtttcgaagctgcaattctcagggaaaaatac
ccagagaaggtcccattccggctaacaagaatgctcacatacgctatggaggtcagtggt
atcgaaggaagcttccgcatcacctgcgaaaatgtcatgaaggtcctgcgagacaacaaa
gaatcgcttatggctattctcgaagcctttgcccacgatccactcatcaactggggcttc
gacctgcctacgcaggctatcactgaacagactggcatacagttgcccgtaacaaacccc
agcgagctcctacgcaatggcgtcattactgcggaggaggccgcccggatggaggtccag
cagcgtgcggaaatcagaaacgccagagctacacttgttctcaagcgcattacggacaag
ctgactggtaacgacttccgcgggttccgtgacctggacgtgccggagcaggttgacaag
ctaattcagcaagccacctctgtcgagaacttgtgccagcattatatcggctggtgctcc
ttctggtga

DBGET integrated database retrieval system