KEGG   Ashbya gossypii (Eremothecium gossypii): AGOS_AFR466CHelp
Entry
AGOS_AFR466C      CDS       T00167                                 

Definition
AFR466Cp
Orthology
K01440  
nicotinamidase [EC:3.5.1.19]
Organism
ago  Ashbya gossypii (Eremothecium gossypii)
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ago00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    AGOS_AFR466C
Enzymes [BR:ago01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     AGOS_AFR466C
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
VI:complement(1281364..1282023)
Genome map
AA seq 219 aa AA seqDB search
MSKALIVVDVQNDFADARGALAVPGAHEIVQPLAELAQDPRWAYVAMTRDWHPPDHVSFA
DTHGRPPFSPYMYHPPPGVRAPPQAGTLWPTHCVQGSWGAQLAPQLAACPVRSPHSVVDK
GVWPDRECYSAFEDIWADRSSGLDGLLRSHGVKHVYVAGLALDYCVKSTAISAARLGYTT
TILLDYTRAIAADAQSMARLSSDLAGHQVALCEGAEPLP
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atgtccaaagctctgatagtggtggatgtgcagaacgactttgcggacgcccgcggcgcg
ctcgctgtcccaggcgcgcacgagatcgtgcagccgctcgcggagctcgcgcaggacccg
cgctgggcgtatgtggccatgacgcgcgactggcacccccccgaccacgtctcgttcgcc
gacacgcacggccggccgcccttcagcccctacatgtaccacccgccgccaggcgtgcgc
gcgccgccacaggcaggcaccctgtggcccacgcactgcgtccagggctcctggggcgcc
cagctcgccccgcagctggccgcctgccccgtccgctcgccgcacagcgttgtcgacaag
ggcgtctggcctgaccgcgagtgctactccgcgtttgaggacatctgggccgaccgcagc
agcgggctagacgggctgttgcgcagccacggcgtcaaacacgtttacgtcgcgggcctt
gccctggattactgtgtcaaaagcaccgccatcagcgccgcgcgcctgggctacaccacg
acgatcctgctggattatacgcgggcgatcgctgccgatgcgcagagcatggcgcggctc
tctagcgatctcgctggtcaccaggtggccctctgcgagggcgctgagcccctgccgtag

DBGET integrated database retrieval system