KEGG   Ashbya gossypii (Eremothecium gossypii): AGOS_AFR485CHelp
Entry
AGOS_AFR485C      CDS       T00167                                 

Definition
AFR485Cp
Orthology
K01694  
tryptophan synthase [EC:4.2.1.20]
Organism
ago  Ashbya gossypii (Eremothecium gossypii)
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ago00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    AGOS_AFR485C
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    AGOS_AFR485C
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    AGOS_AFR485C
Enzymes [BR:ago01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     AGOS_AFR485C
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
VI:complement(1313558..1315681)
Genome map
AA seq 707 aa AA seqDB search
MSILLRKAFTDARDQGRSALVTFMTAGYPSAEATVPVLKGFQDGGADVIELGLPFSDPLA
DGPTIQTANTEALAGGATMKGVLALLREARAGGVTVPIILMGYYNPILSYGEEAFIRDAA
AAGANGFIIVDLPPQDAMKLRGFVQQHGLSLVPLVVPATTDERLAVLAQVADSFIYVVSR
MGTTGASTSVPAHLNDLLKRVRKYSGETPLAVGFGVATREQFCTIGSAADGVVIGSKVVS
LVGDAPEGEHYNTVKTYCEYILAGEKHTLLSPEEFATLHKKYTTEPASIKEIGDIFGETR
KFAPMFGDFGGQYIPEALHACVQELEHAFEAAVEDPTFWEEFRGLYTYIGRPSSFHKADR
LSEYCGGAQIWLKREDLNHTGSHKINNSLAQVLLAKRLGKSKIIAETGAGQHGVATATAC
AKFGLDCTVFMGAEDVRRQALNVFRMRLLGATVIPVTNGTRTLRDATTEAFRYWVGHLES
THYVVGSAIGPHPYPTLVRTFQSVIGRETKEQFAALNDGKLPDAVVACVGGGSNSTGMFS
AFEHDTSVKLLGVEAGGDGLDTEYHSATLTAGRPGVFHGVKTYVLQDSDGQIHDTHSVSA
GLDYPGVGPELAAWKASGRVEFIAATDAQALEGFKLLSQLEGVIPALESSHAVYGAVQLA
KTMRPDQHIVINISGRGDKDVQTVAEVLPKLGPQIGWDLRFEPDTAA
NT seq 2124 nt NT seq  +upstreamnt  +downstreamnt
atgtctattttgttgcgcaaagctttcacggacgcgagagatcagggtcgcagcgccctg
gtgacatttatgacggcggggtacccaagcgccgaggccacggtcccggtcctcaagggg
ttccaggacgggggcgcggacgtgatcgagctggggctgccgttctcagaccctctagcg
gacggcccgacgatccagacggcgaacacagaggcgcttgccgggggcgcaacgatgaag
ggggtgctggcgctgctgcgggaggcgcgggccgggggcgtgacggtgccgatcatcctg
atgggctactacaacccgattctgagctatggggaggaggcgttcatccgggacgccgca
gcagcgggggcaaacgggttcatcatcgtggacctgccgccgcaagacgcgatgaagctg
cgcggcttcgtgcagcagcacgggctgagcctggtgccgcttgtcgtgccggcgacgacc
gacgagcggcttgcggtgctcgcgcaggtggcggactcgttcatctacgttgtgtcgcgc
atgggcacgacgggcgcgagcacctcggtgcccgcacacctgaacgacctgctcaagcgc
gtgcgaaaatactcgggcgagacgccactggctgtgggcttcggcgtagcgacacgagag
cagttctgcacgatcgggtcggcggcagacggcgtggtcatcggctcgaaggtggtgtcc
ttggtcggcgacgccccggagggcgagcactacaatactgtcaagacctactgtgagtac
atcctggccggcgagaagcatactttgctgtcgccggaggagtttgccactctgcacaaa
aagtacaccaccgagcccgcgagcatcaaggagattggcgacatattcggcgaaacgcgc
aagttcgcgccgatgtttggtgatttcgggggacaatacatcccagaggcgctgcatgcg
tgtgtgcaggagttggaacatgcatttgaggccgccgtggaagacccgaccttctgggaa
gaattcaggggcctctacacctacatcggaaggccatcgtctttccacaaggcggatcgc
ctgagcgagtattgcgggggagcgcagatttggcttaagcgtgaggacctcaaccatacg
ggttcgcacaagatcaataactccctagcacaagtgcttttggccaagcgtctaggcaag
tccaagatcattgcagagaccggcgccggccagcacggagttgcaactgctacagcatgt
gccaaattcgggttggactgtaccgtgttcatgggcgcagaggatgtgcgccgccaagca
ctcaacgttttcagaatgcggctgttgggggccacggttattccagttaccaacggaact
cggacgctccgtgacgccaccacggaggcgtttaggtactgggtgggccatttagaatct
acgcactatgttgtcggctctgcaattggtccgcatccctacccaaccctggtcagaacg
ttccagagtgtcatagggagggaaacaaaggagcagttcgcagcgctgaatgacggtaag
ctcccggacgcagttgtggcatgtgtcggcggtggctcaaactccaccggtatgttctct
gcgttcgagcacgatacctctgtgaagctgcttggtgttgaagccggtggagacggtctc
gacacagagtaccattctgccactttgactgccggacggcctggtgtcttccatggtgtc
aaaacttacgttctccaagactctgacggtcaaattcacgacacacattctgtctcagct
gggctggactatcctggtgttggccccgagctagctgcctggaaagcttccggacgtgtt
gaatttattgctgcaacagacgctcaggctctcgagggctttaagctcctgtcgcaactg
gaaggggttatcccggcgctggagtcctcccacgctgtgtacggcgctgtccagctcgca
aagactatgcgccctgaccaacacattgttatcaacatttctggcagaggtgacaaagat
gtccaaacggtcgcagaagttctcccgaagcttggcccgcagattggctgggatctaagg
tttgagcctgacactgcggcttga

DBGET integrated database retrieval system