KEGG   Ashbya gossypii (Eremothecium gossypii): AGOS_AFR529WHelp
Entry
AGOS_AFR529W      CDS       T00167                                 

Definition
(RefSeq) AFR529Wp
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
ago  Ashbya gossypii (Eremothecium gossypii)
Pathway
ago00052  Galactose metabolism
ago00500  Starch and sucrose metabolism
ago01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ago00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    AGOS_AFR529W
   00500 Starch and sucrose metabolism
    AGOS_AFR529W
Enzymes [BR:ago01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     AGOS_AFR529W
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C
Motif
Other DBs
NCBI-GeneID: 4622355
NCBI-ProteinID: NP_986076
UniProt: Q752P4
Position
VI:1389255..1390973
Genome map
AA seq 572 aa AA seqDB search
MYFSKLLSAVALCSSASALYVPGDADVNVQNKDQTPTALPEEPLNGTAYRPIMHATPSQG
WMNDPNGLWYDTKEEVYHVYYQYNPADTVWGVPLYWGHLTSKDLQSWEDHGVAIRPPRND
SGAFSGSAVVDTNNTSGFFNDSIDPAQRVVAIWTYNTPESETQWISYSLDGGYTFIDYAN
NPVLDLNSTQFRDPKVIWHEESQKWIMTVVLSHKYAIQIYSSDNLREWTLESEFKNHGLL
GFQYECPGLAKIPVSKPANCEMQLKDVSYPVKNNTDYVWVMFLAINPGGPQGGNFNQYFI
GDFDGKKFTPFSEQTRFLDHGKDFYAFQGFYNSQFKDSFLGIAWASNWQYSAYVPTNPWR
SSMSLARKLTVRPYNPTPESVQLVLNSEPVFVPEDMEFNSNFSSWKDLKLTSGKEEVFEF
GSTPLGAFEFNLTFTANDTGLSKHSLGDFSIYLEGAKDPDEYLRLGYSTQAADFFFDRGN
SKVSFVRENPFFTNKMAINMEPWEILAPGVKVFKVRAIFDVDILELFFNEGTAASTNTYF
LTEENHPASLKFKTSVDNVFTVNELSLRQLTF
NT seq 1719 nt NT seq  +upstreamnt  +downstreamnt
atgtatttttctaagctactaagcgcagtcgcactctgcagcagtgcttctgcactgtat
gtgcctggagatgctgatgttaacgtgcaaaataaggaccaaacgccaacggctttgccg
gaggaaccattgaacggtaccgcatatcggcccattatgcatgcaactcctagccagggt
tggatgaacgaccccaatggtctttggtatgacactaaggaggaagtgtaccacgtttac
taccagtacaaccctgctgacactgtctggggtgtgccactctactggggccacttgaca
tccaaggacttacaatcttgggaggaccacggtgttgcgattcgccccccacgcaacgac
tctggcgctttctctggctctgctgttgtcgataccaataacacctccggttttttcaac
gactccattgaccctgctcagagagttgtcgctatttggacctacaacacgcctgaatcc
gagacccaatggatttcttactctctagatggtggctacacgttcattgattacgcgaat
aaccctgtccttgacttgaactctactcagttcagagatccaaaggtgatctggcacgag
gaaagccaaaagtggatcatgaccgttgtcctatctcacaagtacgctatccaaatctac
tcctctgacaacctgagggaatggaccttggaatcggagttcaagaaccacggtctgctt
ggcttccagtacgagtgtcctggccttgccaagattccagtttccaagccggccaattgc
gaaatgcagttgaaagacgtctcctacccagtcaagaacaacacggactacgtgtgggtg
atgttcttggccatcaacccaggtggaccacagggtggcaacttcaaccagtacttcatt
ggcgacttcgacggcaagaaatttactccgttcagtgagcagactcgcttcctggaccac
ggaaaggacttctacgcgttccagggattctacaacagtcaattcaaggacagcttcctc
ggaattgcctgggcttcaaactggcagtattcagcatacgtgccaaccaacccatggaga
tcctcgatgtctttggcaagaaagctaactgtcaggccctacaaccccactccggaaagt
gtccagcttgttctgaactcggagcctgttttcgttcctgaggatatggagtttaactcc
aacttctcgagctggaaagatctgaaattgacttccggaaaggaggaggttttcgagttt
ggatctacgcctctcggtgccttcgagttcaacctgaccttcacggcaaacgacaccggc
ttgtctaagcactccctaggcgacttcagcatctacctagagggggcaaaagaccccgac
gaatacttgaggcttggctacagcacacaggccgccgacttcttcttcgaccgcggcaac
tccaaggtctccttcgtgcgcgagaacccgttcttcacgaacaagatggccatcaacatg
gagccttgggagatcctggctccaggcgtcaaggtcttcaaggtccgcgccattttcgac
gtggacatcctcgagctgttcttcaacgagggtaccgcggcaagcaccaacacgtacttc
ctgacggaggagaaccaccccgcttccctgaagttcaagacttccgtcgacaacgtgttc
accgtcaacgagctaagtctgcgccagctgactttttaa

DBGET integrated database retrieval system