KEGG   Ashbya gossypii (Eremothecium gossypii): AGOS_AFR551WHelp
Entry
AGOS_AFR551W      CDS       T00167                                 

Definition
AFR551Wp
Orthology
K11366  
ubiquitin carboxyl-terminal hydrolase 22/27/51 [EC:3.1.2.15]
Organism
ago  Ashbya gossypii (Eremothecium gossypii)
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
VI:1431010..1432419
Genome map
AA seq 469 aa AA seqDB search
MMVCPHMEQVIQTAKVGDAVVKECITVRYLIRNCDAKSRYLRAMRCSECFQINCGSSFMC
LQCGFVGCWNESHFLHHSKKVGHIFGVNATNGLLFCFRCRDYISDNEFVHMDIMPKHWNE
VLRRSSIPAPHRGEGLLGLVNMGSTCFMSSVIQTFLHLPHVLQYMLERLHYATCDVQDSL
SCISCAVDEIVANLYGQVKEEAASGVAGPGASTQALSQSLSKQQQGFINLLTCSWKINRN
LAGYSQQDAHEFWQFLLNQLHTDYIRIHGPPSKKSACGCILHMLFQGYLESSIVCSECHG
NNKTTVDPIMDLSLGIQNKSTLHECLDSFHRRESLTDFNYCCKNCMSTSNPIRQLSMAKL
PPVLMLQLKRFEHLINGTSVKINDYISFPLHLNMKDYCKPMDDQHPVPNMTFKLSAIISH
QGTVDKGHYTTICRINGDVWAKFNDSMVTLISEEDMLKEQAYLLYYVIS
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atgatggtgtgtccgcatatggagcaggtgatccagacggcgaaggtgggcgatgcagtg
gtgaaagagtgcatcacagtacgatatctgatccgcaactgcgatgccaagagcaggtac
ctgcgggcaatgcggtgctcggagtgtttccagatcaattgcggtagcagcttcatgtgc
ctacagtgtggattcgttgggtgctggaatgagagccactttctgcatcacagcaaaaaa
gtgggacatatcttcggcgtgaatgcaacgaacgggctgctgttctgctttcgatgcagg
gactacatcagcgacaacgagtttgtgcatatggacattatgccgaagcattggaacgag
gtgttgcgccggagctccatacccgcgccgcaccgcggcgaagggctgcttgggttggtg
aacatgggctcgacatgcttcatgagcagcgtgattcagaccttcctgcacctgccgcat
gtgctgcagtacatgctggagcggctacactacgccacctgcgatgtgcaggacagtttg
tcgtgtatctcgtgcgctgtggacgagatcgttgcgaacctgtacgggcaggtcaaggag
gaggcggcttccggcgtggcgggcccaggcgcttctacgcaagcgctctcgcagtctctg
tccaagcaacaacaaggcttcatcaacttgctgacctgttcgtggaagatcaacaggaac
ctagccgggtactcgcagcaggacgcccacgagttttggcagtttctgctaaaccaactg
catacagactacatcaggatacacgggcctccatccaaaaagtcagcttgcggttgtatc
ctgcatatgttgtttcaaggctaccttgagtccagcattgtctgctcggagtgtcacgga
aacaataaaaccaccgtcgatcccattatggatctttccctcggaattcagaataaatcc
accctgcatgaatgtttggattcttttcatagaagggagtcactaacggattttaattac
tgctgcaaaaactgtatgtccactagcaatccgatccgacagctttccatggctaagctc
ccaccggtcctaatgctgcagttgaagcgctttgaacacctaataaatggcaccagtgtt
aaaattaacgactatatttcttttccgttgcatctaaacatgaaggactattgcaaacct
atggacgatcagcatcctgttccaaacatgaccttcaagctttcggctatcatttcccat
caaggcaccgttgacaagggccactataccaccatttgcaggataaatggcgacgtgtgg
gccaagttcaacgactccatggtcaccctgatttccgaggaagacatgttaaaggaacaa
gcataccttttatactacgttattagctaa

DBGET integrated database retrieval system