KEGG   Ashbya gossypii (Eremothecium gossypii): AGOS_AFR559CHelp
Entry
AGOS_AFR559C      CDS       T00167                                 

Definition
AFR559Cp
Orthology
K09584  
protein disulfide-isomerase A6 [EC:5.3.4.1]
Organism
ago  Ashbya gossypii (Eremothecium gossypii)
Pathway
Protein processing in endoplasmic reticulum
Class
Genetic Information Processing; Folding, sorting and degradation; Protein processing in endoplasmic reticulum [PATH:ago04141]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
VI:complement(1439201..1440127)
Genome map
AA seq 308 aa AA seqDB search
MAQDANTASSTPGRIANMKIGLLAAALGGLAAAQNLYDRNPHVMELTAKTFKRAVHGTNH
TTLVEFYAPWCGYCQKLKPTMERAARALDGLMQVAAVNCDVDANKQLCVKHDVRGYPTLA
VFQPAPAKAGARARHVRELYQGQQKLRPLVDFSLGRIRNHVRRLDGDKLRALFDEGGPRP
AAVLVSARERVAPLYKSMAIDWLGAVDFAFVAAAKLPKDTPVPDRPGLAPCAEHLAEHLD
RSALLLFNPQADECRVYSGELTKPAVAEFLSQAAMPREGPLSKRERFLETLKGKKRTRGP
DHDDRDEL
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atggcacaagacgcaaacacagcaagtagcacaccaggccgaatagcaaacatgaagatt
ggactactggcggcggcgttaggcggcctggcggccgcgcagaacctctacgaccgcaat
ccgcacgtcatggagctgactgccaagacgttcaagcgggctgtgcacggaacgaaccac
acgacacttgttgagttctacgcgccttggtgtggctactgccaaaaactgaaacccacg
atggaacgcgcagcgcgggccctggacgggctgatgcaggtcgcagcggtcaactgcgac
gtggacgccaacaaacagctgtgcgtcaagcacgacgtccggggctacccgactctggca
gtgttccagccggcgccggccaaggcgggcgcgcgtgcacgccacgtgcgcgagctctac
cagggccagcagaagcttcggccgctggtagacttcagcctggggcgcatacgcaatcac
gtgcgccgcttggacggcgacaaactccgcgcgctgttcgacgagggcggcccgcggccc
gcagcggtgctcgtgtcggcgcgcgagcgcgtggcgccgctgtacaagagcatggccatc
gattggttgggcgcggtagacttcgcctttgtggcggccgcgaagctgcccaaggacacg
cccgtgccggaccgccccgggcttgcgccgtgcgccgagcacctggccgagcaccttgat
cgtagtgcgctgctgctgtttaacccgcaggccgacgagtgccgcgtctacagcggcgag
ctgaccaagcccgccgtcgcggagtttctctcgcaggctgccatgccgcgggagggcccg
ctctcgaagcgcgagcgcttcctggagacgctgaagggcaagaaacgtactcgcgggccg
gaccacgacgaccgcgacgagctgtaa

DBGET integrated database retrieval system