KEGG   Ashbya gossypii (Eremothecium gossypii): AGOS_AFR626WHelp
Entry
AGOS_AFR626W      CDS       T00167                                 

Definition
AFR626Wp
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
ago  Ashbya gossypii (Eremothecium gossypii)
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:ago00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    AGOS_AFR626W
Enzymes [BR:ago01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     AGOS_AFR626W
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
VI:1575224..1576231
Genome map
AA seq 335 aa AA seqDB search
MGVTVIGSLNYDLVTYTDKVPGAGETFAGEHFETHVGGKGLNQAIAVSKLQADAGDEKVR
IVGNVGRDPFGDEILEVARQNRVQVEHVGVVAGTKTGTATILVERKTGQNRIVIVSGANA
KTVLEESNMEQVFPKNTSPGQHYIILQHEISDPVAYMRWLKLNRPAYQIVFNPSPFQELP
ADAWKDVDVLVVNEVEAFQLYMCITGSGSSKFSESEPDNMVDKFRVILSELMERGVLGKS
RSGTIIVTLGEYGVLYASAASSRVLYVPAEQVVKVVDTTAAGDTFLGGLVAQLDSGSTLD
DAVRFAVQASAIAVTREGASSSIPTHAEVEGKYHL
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atgggagtgacggtaattgggtctttgaattatgatttagtcacgtatactgacaaggtt
cctggcgcgggggagacatttgcgggggagcacttcgaaacccatgtaggtggcaagggc
ttgaatcaggcaatcgcagttagtaagctacaagcggatgcgggcgatgagaaagtgcgt
attgtgggcaatgtaggtagggatccatttggagatgagatcttggaagtggctagacag
aatagggtgcaggtcgagcacgttggtgtagtggcggggactaagacaggcactgcgact
atcctagtagagcgcaagacaggacagaaccggattgtgattgtgagcggggctaatgcg
aagacggtcttagaagaaagtaacatggagcaagtgttcccgaagaatacttccccaggc
caacactacattatccttcagcatgaaatctccgatccagtagcatacatgcgctggctg
aagctcaataggccagcttaccaaattgtgttcaacccttcgccgtttcaggagctacca
gcagatgcatggaaggacgtggatgtcttggtggtcaatgaagttgaggcttttcagctt
tacatgtgcattacgggctctggaagttctaagttctccgaatcagagccagataatatg
gtagacaagttcagggtaattttaagtgagctcatggagaggggggtactcggcaagagt
cgttctggcacaattatagtaaccttgggagaatacggtgtcttgtacgcttctgctgcg
agttcaagggttctttacgtccccgcagagcaagtcgtgaaagtcgtggacactaccgcc
gcaggtgatacattcctgggtggattggtcgcccaactagactctgggtccacgctagat
gatgctgtgcgctttgcagtacaggctagtgcaattgctgttacaagggaaggcgcatct
agtagcataccaacgcatgcagaagttgagggaaaatatcatttgtga

  All links  
No link information was found.   
DBGET integrated database retrieval system