KEGG   Ashbya gossypii (Eremothecium gossypii): AGOS_AFR627CHelp
Entry
AGOS_AFR627C      CDS       T00167                                 

Definition
AFR627Cp
Orthology
K11835  
ubiquitin carboxyl-terminal hydrolase 4/11/15 [EC:3.1.2.15]
Organism
ago  Ashbya gossypii (Eremothecium gossypii)
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
VI:complement(1576325..1580188)
Genome map
AA seq 1287 aa AA seqDB search
MSMENTTEEVEPREQAVQAAEFEGVEVADQWERPIEEGALIEAGADNGELAEDSASRAGR
FTEGRFAEVSDESDSMLVDAIPSLEEQRAIVNRLWEGFVKESSEGDKMYIVPNSWLSTFF
DQEQTDYTVLGQLDIKSIVVDQENLILVPYETCPYTAVPEPVFAQWYEWYGLAEGSSPLC
TYLVENTQGQLAVEYDRPKFRLHHLSLHEESHGYHHYGPQSPILFTMSRLHTVGDMVSHA
IELFCRRENQANVNDVSFRTWYVGDSNTGPGEHSEYLAANYKFTPSAFIEIPSKYLFKKD
QFSRAIKSFDVHSFDLVIEVKQHGKDQHWPSNFYVYNQLLSSKGTIGLSNLGNTCYMNSA
LQCLLHIPEFKDYFLYNGYEKEVNIENPLGHKGHIAWAFASMVQALFGKRHSAATSYSPR
NFKNTIGHLNSMFSGYQQQDSQEFLAFLLDGLHEDLNRIIEKPYVEKPELTSTDDTAEFK
VIKKLADDTWGKHKLRNDSVITDLFVGLYKSTLICPVCKKTSVTFDPYNDLTLPLPVNST
WSNKVLIFPHNSHPYSLEVELKKTDTYQQLKEYVAKCANVDPANLFGAEVFNHQFYNNYE
APNSESQYLPIHELIGDSDVVVFYEIPRSEDSILIPVMNTIIEAGFKSAKLCGYPFFISL
TKKEQSHYGIILEKLENAFLNLSGGFTEFPIISRKISDLTLESLPLLSEKIANPPTKELA
AHLSYINPDETPNRMFDVKLYNGSGNQYNSNDNTADEPVRIKEVWTPEPHVTFSKVSDIT
ERLNPIVKDAYFYAELASAHEQQQSAITLPDSGDILDDTGLNLLTTSTQEAGCVQLSSPN
PESAQLSELGPTKTDSVEAMHLPLPSDSDMDIEVYSELDMNKQTLSKDPSQAPLTQSASA
YSGPAPLLVDFQNALICEWKSEKYEEVFHSSVPYSWERPDTLRNEELEVIREKRRASGEK
KITLHDCLTLFSTPEVLGATDSWFCPNCKEHRQATKQIELWNAPDILLIHLKRFENQRSF
SDKIADTVHFPITDLDMTPYLVYKNEDKGDIYDLIAVDNHYGGLGGGHYTAYVKNIDGKW
YYFDDSRVSETLPERSIAGSAYLLFYRRRVESGYLGTERLSQIILESRQKHEQVLKKFSE
AVIDLYSESKSDDEEEEEKNEEKNRENSFLMPSREDETNAGQQEEPSQLETESSVPQPDK
KGAYPLKGMVSPHSEYSIASLEVGDGEKIDESGDIDHNNSRRKLRLLQKTYNSHSSDVAT
SGSSSSSSTGAVVEEIQEAENIDHKRN
NT seq 3864 nt NT seq  +upstreamnt  +downstreamnt
atgagtatggaaaatacgacagaggaggtagaaccacgtgaacaagctgtgcaggcagca
gaattcgagggtgtcgaggttgccgatcaatgggagcggccgatagaggagggagcgcta
atagaggccggagcggacaacggggagttggcagaagacagtgcgagcagggcggggcgg
tttacagaggggcggtttgcagaagtgtctgatgagagcgattcgatgttggtggatgca
atccctagcctggaagagcagcgtgcaattgtgaaccggttgtgggagggttttgtaaag
gagagcagcgagggagataagatgtacattgtcccaaacagttggctgagcacatttttc
gaccaggaacagacagactacacagtgctagggcagctcgacatcaagtcaatcgtagtg
gaccaggaaaacctaattctcgtgccctacgaaacctgtccatatactgcggtcccagaa
cctgtgtttgcgcagtggtatgaatggtacgggttagcagaaggttcttcgcctctttgc
acgtatcttgtcgagaacacgcaagggcagctagctgtagaatacgacaggcctaaattc
cgtctccaccatctttcgttgcatgaggagtcccatggttaccaccattatggaccacag
agtcccatattattcacaatgtcgcgattgcacaccgtaggcgatatggtgtcccatgcg
attgaattattttgcaggcgcgagaatcaagccaatgtgaacgatgtttctttccggacc
tggtatgttggggattcgaacacaggtccgggtgagcacagcgaataccttgctgccaac
tacaagtttactccctctgccttcattgaaataccttccaagtacctattcaaaaaagac
cagttttctcgcgcaataaaaagctttgatgtgcattcctttgacctcgtaattgaggtc
aagcaacatgggaaagatcagcattggccctccaacttttatgtttacaaccagctttta
tcatcgaaggggacaatcggtctgtcgaacttgggaaacacctgttatatgaactctgca
ttgcaatgccttttacatattccagaattcaaggattactttttgtacaatggctatgag
aaagaagttaatattgaaaatccattgggtcataagggccatatagcatgggcatttgct
tccatggtacaagcactttttgggaagcgacactctgctgctaccagctactccccccgt
aacttcaaaaacaccattggtcatctcaattcaatgttctctggttatcagcagcaagac
tcacaggaattcttagcctttttgctagatggtctacatgaagacctcaataggattata
gaaaagccatatgttgaaaagcctgaattgacatcaactgatgataccgccgaattcaag
gttataaaaaagttagcagatgacacatggggaaaacataaactccggaatgactccgtg
ataacagatttgtttgtgggtctatacaagtccacattgatttgtcctgtctgcaaaaag
acatctgttacatttgatccgtataacgacttaacattgccgttaccggtgaacagcacg
tggtcaaacaaagtccttatcttcccacacaactctcatccatactcgcttgaagtggaa
ttaaagaaaacggatacatatcagcaactaaaagaatacgttgcaaaatgtgccaatgtc
gaccctgccaatttatttggtgctgaggtttttaaccatcagttttacaataattatgaa
gcacccaattcagaatcccagtacctaccaatccatgagctgataggcgatagtgatgtg
gtggttttttatgagataccgcgtagcgaggacagtatcctaatacctgtcatgaatact
attatagaagcaggattcaaatctgcaaaactctgtggatatcctttttttatttcctta
acgaaaaaagaacagtcccattatggtatcatactggagaagcttgaaaacgccttcctc
aatctgtctggtggattcactgaattcccaataatttcacgcaaaatatcggatcttaca
ttagaatctctgcccttactctcagaaaagattgctaatccacctacaaaagagttggcc
gctcatctatcatacattaatcctgatgaaacccccaacaggatgttcgatgtgaagcta
tacaacggttcagggaatcaatacaattctaacgataataccgcggacgaacctgtacgg
ataaaggaagtatggactcccgaacctcatgtcacttttagcaaagtttcggacattacc
gaaagactaaaccccatcgtcaaagatgcatatttttatgctgaactggccagcgctcat
gagcaacagcagtcggccattactctgcctgatagcggagatatactggatgataccggg
ttaaatcttctgaccacctcaactcaggaagctggctgtgtacagctgtcttctcctaat
cccgaatctgctcaactatcggaacttggtccaacaaaaacagatagtgttgaagctatg
catttaccgttaccatctgactcggatatggatattgaggtatacagtgaacttgacatg
aataagcaaaccctttccaaggatccttctcaagcgccgcttacacaatccgcatctgct
tatagtggtccggcgccattattagtcgactttcagaatgcactaatatgcgaatggaag
tctgaaaagtacgaagaggtgttccactcttctgtaccttactcttgggaacggcctgat
accttgagaaatgaggaattagaagttatccgggagaagcgcagagctagcggagagaag
aagataacactacacgattgtctgactctcttttccacaccagaagtactaggtgctact
gactcgtggttttgtccaaactgtaaagaacatcggcaggctacaaaacagattgaacta
tggaatgcacctgatattcttttgattcacttgaagcggtttgagaatcagagatccttt
agtgataaaatcgctgacaccgttcacttcccaattacagaccttgatatgaccccatac
ctcgtctacaaaaacgaggataaaggagatatttatgacttaattgcagtggataatcac
tatggtggcctcgggggaggccactacacagcatacgttaaaaacatagatggtaaatgg
tattattttgatgattcccgtgtcagcgagaccttgccagagagaagcatagcaggttca
gcctatttgttgttctacaggaggcgagtggaatctggctacttaggtactgagaggtta
tcccagataattcttgaatctagacaaaagcatgagcaagtgttaaaaaagtttagcgaa
gctgtcattgatctgtattctgagagcaagtccgacgatgaagaagaagaggagaagaat
gaggagaagaatagagagaacagctttttgatgccttcaagagaagatgaaacgaatgct
ggacaacaggaagaaccttctcagcttgagacggaaagttcggtaccacaaccggacaag
aaaggagcatatccacttaaaggtatggtcagcccgcatagtgaatacagcattgctagt
cttgaagtaggagatggcgaaaaaatagacgaaagtggagatattgatcataataatagc
cggaggaaactccgcctattgcagaagacatacaattcgcattcgtctgatgtagccacc
tctgggtcgagttcctcctcctcaacaggcgccgtagtggaggaaattcaagaggcagaa
aatatagatcataagaggaactaa

DBGET integrated database retrieval system