KEGG   Ashbya gossypii (Eremothecium gossypii): AGOS_AFR647CHelp
Entry
AGOS_AFR647C      CDS       T00167                                 

Definition
AFR647Cp
Orthology
K13939  
dihydroneopterin aldolase / 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase / dihydropteroate synthase [EC:4.1.2.25 2.7.6.3 2.5.1.15]
Organism
ago  Ashbya gossypii (Eremothecium gossypii)
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:ago00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    AGOS_AFR647C
Enzymes [BR:ago01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     AGOS_AFR647C
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     AGOS_AFR647C
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.25  dihydroneopterin aldolase
     AGOS_AFR647C
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
VI:complement(1618660..1621122)
Genome map
AA seq 820 aa AA seqDB search
MQSLGFKCLLSRRSLSRISICTRGMSSANGGRSNDTVHIQRQALKVVAGLDGWGQLQAQD
VKLTMNMNTDFRASSQTDDLKYSLNYAVISRGVHRFVEGCGRYRSLGHLAREVKKFSMNE
YPGIQTIEVGAEADAAHLRCGSLGVVVNSDGHRPDEILLSGMKLLTLIGVFTFERRRKQY
VDLKLSFPWPKEAGEFPDCQELLDDVVSYVERANFKTAESLAESVAHVVTLREYFQLHRG
LPVKVKVIKLNAITETEGVGVSCVRSADEFTGKPPFWEDIPNDRADVFNLPVFQQPHASV
SEWNRVFLAFGSNIGDRFAHIERSLRLLAEDPKVKLLRSSSLFESEPMYFKEQSPFMNGV
VEVQTRYSPHELLELCKRIEYEHLKRVKEFDNGPRSIDLDILLYQNANFEHVVLNSEDLV
IPHPRMLERSFVLEPLCELLAFHEVHPISAESVQSHLKELYRKGNKEDILVKLVPLPGIP
SNIPTTRFLKFRREYEEDQSTSELVLRTKSNTYVMGIVNVTPDSFSDGSPMWNDVNHFLL
KVQRMILDVLKLHENVIIDIGGCSTRPGSQQPSVEEELSRTIPLITAIRGCRDFSQENVI
ISIDTYRSAVAEKAITAGADIVNDISGGSFDTNMFKVISAYPNVGYVLSHIRGDMTTMTS
LNKYDDTVGLDGVEEFIYGKKQHSERTKVIRNICRELAERYQLALASGIKRWQIILDPGI
GFAKNAKQNLDIIKHTPSIKGYSCVTHGQFVNFANLPVLLGPSRKNFIGTIIQEAQVERR
DFATGTIVGSCVGYDADIIRVHDVTNCSKSARLADELYRK
NT seq 2463 nt NT seq  +upstreamnt  +downstreamnt
atgcagtcccttggattcaagtgtttgctgtctcgcaggagcctgagcaggatatcaatc
tgtacaagaggaatgagtagtgctaacggtggacgaagtaatgatactgtgcatatacag
agacaggcactgaaagttgttgctgggcttgacggatggggtcaattgcaggcgcaggat
gtgaaattgaccatgaatatgaacacagattttcgtgcttcctcgcagacggatgatctg
aagtactccttgaattatgcggtgatttcacgtggggtgcataggttcgttgagggctgt
ggacggtaccgctctcttggtcacttggccagggaggtaaagaagttttccatgaatgag
tatccgggtatccaaactatagaggtgggtgcggaggcggacgcggcccatttgcgatgc
ggaagtctgggcgtcgtggtgaacagcgatgggcatcgtcctgatgagattttgctttct
ggaatgaagcttctgacactaataggggtgttcacttttgaacggcgtcggaagcagtac
gttgacttgaagctgtcatttccgtggccgaaggaggctggtgaatttccggattgccag
gaattattggacgatgttgtgagctatgtagagagagcgaattttaaaacggcagagtct
cttgctgagagtgtagctcacgttgttaccttgagagagtattttcagctgcatcgtggg
ttaccggtaaaagtcaaggtaattaagcttaatgccattactgagactgagggagttggt
gtgagctgtgtaagaagtgcggatgaatttacggggaaaccgcccttctgggaagatatt
ccaaacgatcgagcagacgtgtttaaccttcctgtattccagcagccacatgcatctgtc
agtgagtggaatcgtgtgtttctggcgtttggatctaatataggggataggtttgctcac
attgagcgaagcttacgtctacttgcggaagatcctaaagttaaactacttcgctcgtcg
tctctgttcgagagtgaaccaatgtactttaaggagcagtccccgtttatgaatggcgtt
gtagaagtgcagacacggtatagcccgcacgagttactagagctatgcaaaaggatagaa
tatgaacatttaaaacgtgtcaaagagtttgataacggccctcgcagcattgatttagat
attttattgtaccaaaatgcaaactttgagcatgtggtactgaactccgaggatttagtt
attcctcatccaaggatgttggagagatcgtttgttttagagcctctctgtgaattgttg
gctttccatgaagtgcaccccatttcggctgaatctgtccaaagtcacctaaaagaattg
taccgtaaggggaataaggaagacattcttgttaaacttgtacctttgccgggtattccg
tcaaatatacctacaacgcgatttctgaagtttagacgggagtatgaggaggatcaatcg
acaagcgaattggttcttaggaccaagtcaaatacatatgtcatgggcatcgtgaatgtg
acacctgattctttttctgatggatctcctatgtggaatgatgttaatcatttcctctta
aaagtacaaaggatgatccttgacgttttgaagttacatgaaaacgttatcattgatatt
ggaggctgttcgactaggcctggtagtcagcaaccatcagtggaagaagaacttagtcgt
actattcccctaataacagcgatcaggggttgcagagatttttcgcaagagaatgtgatc
atatctatagacacttacagaagtgctgttgctgaaaaggccataacagcaggggctgat
attgtgaacgatatttcaggaggtagttttgatacaaatatgtttaaggttatcagcgcg
tatccgaatgttggttatgtgctatcacacataaggggagatatgactaccatgacgagc
ctgaataagtatgatgatacagttggtttggatggcgttgaagaattcatttacggtaag
aaacagcactcagaacggactaaggtgatccggaacatttgtagggaacttgcggagcga
taccagcttgcccttgctagcggaattaagcgctggcagattattttggatccgggtatt
ggttttgcgaagaatgctaaacagaacttagatatcatcaagcataccccgtcaattaag
ggttatagttgtgtgacacatggacaatttgtaaattttgccaaccttcctgtgttgctt
gggccttccaggaagaactttattgggactataattcaagaggcacaggtcgagcgaagg
gactttgcaacggggactattgtaggctcctgtgttggttatgatgcggatatcatcagg
gtacatgatgtaactaactgtagcaaaagtgctaggttagcggatgagctttataggaaa
tag

DBGET integrated database retrieval system