KEGG   Ashbya gossypii (Eremothecium gossypii): AGOS_AFR718WHelp
Entry
AGOS_AFR718W      CDS       T00167                                 

Definition
(RefSeq) AFR718Wp
  KO
K09580  protein disulfide-isomerase A1 [EC:5.3.4.1]
Organism
ago  Ashbya gossypii (Eremothecium gossypii)
Pathway
ago04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:ago00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    AGOS_AFR718W
Enzymes [BR:ago01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     AGOS_AFR718W
Chaperones and folding catalysts [BR:ago03110]
 Protein folding catalysts
  Protein disulfide isomerase
   AGOS_AFR718W
Membrane trafficking [BR:ago04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   PDI family proteins
    AGOS_AFR718W
Exosome [BR:ago04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   AGOS_AFR718W
  Exosomal proteins of colorectal cancer cells
   AGOS_AFR718W
  Exosomal proteins of bladder cancer cells
   AGOS_AFR718W
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thioredoxin Thioredoxin_6 AhpC-TSA Thioredoxin_2 Thioredoxin_7 OST3_OST6 Redoxin Thioredoxin_8 DUF1539
Motif
Other DBs
NCBI-GeneID: 4622555
NCBI-ProteinID: NP_986266
UniProt: Q751V7
Position
VI:1762567..1764126
Genome map
AA seq 519 aa AA seqDB search
MLFDKRFVLSIAGLLAQFAQAQDATAPEDSAVVKLTGETFGKFLEENPLVMAEFYAPWCG
HCKHLAPEYVKAAGELAEKGIKLAQVDCEQELDLCAGQNVRGYPTLKVFHSGASEEGMPY
TGARKAEEIVAYMLRQAEPAVTVLEGKEAAQDLEDLLAESKTAVVVDGGVKGLNESFYEL
ANLLRNDFVFVQYPTKKPTLAVHLPGEKEPIVFEGKNTTLPHLVDWISVESLPYFGEVDA
ITYQKYMTSDLPLAYFFYSSEEEREQYAGLFRKLGKAHRGSLNFAGLDAVKYGQHAENLN
MKQQFPLFVIHNATSDLKYGLPQLSDEEVSAGTAVTIKEADIEKFVVDFLDSKIEPIIKS
EDVPEVQESSVYKLVATTHDQIVKDEDKDVLVKYYAPWCGHCKKMAPTFEELADVYANDE
DAKNKVLIADIDATLNDVHGVVIEGFPTIVLYPAGKDSTPVVYQRSRSLEEFLDFIKEEG
THKVDGQAIHARNAETAADKPAEKAEAEAEDADLERDEL
NT seq 1560 nt NT seq  +upstreamnt  +downstreamnt
atgctttttgacaagcggtttgtgttgtccatcgccgggttgctggcacagtttgcacag
gcccaagatgccactgcaccagaggactctgcagtggtcaagttgaccggagagacgttc
gggaagttcttagaggagaacccgcttgtgatggcggagttttatgcgccatggtgtggc
cactgtaagcacctggcaccggagtacgtgaaggcggctggggagctggccgagaagggc
atcaagctggcgcaggtggactgcgagcaggagctggatctatgcgcgggccagaacgtg
cgcgggtacccgacgctgaaggtgttccacagtggggcgtcagaggagggcatgccatac
acgggcgcacgcaaggccgaggaaattgtggcgtacatgctgcgccaggccgagccggcc
gtgacggtgctggagggcaaggaggccgcccaggacctggaggacctgcttgcggagtcc
aagaccgcagtggtggttgacggtggcgtgaagggcctgaacgagtccttttacgaactg
gccaacctgctccggaacgactttgtatttgtgcagtacccaactaagaagccgaccttg
gcggtccacttgccgggcgagaaggagccaattgtgttcgagggtaagaacaccacgctt
cctcaccttgtcgactggatctccgtcgagagcctgccttactttggcgaggtcgatgcg
atcacctatcagaagtacatgacctcagacctgcctttggcttacttcttctactcttcc
gaggaggagcgcgagcaatacgcaggcctcttccgcaagctgggcaaggcgcaccgtggc
tccctaaactttgctggcctagacgccgtcaagtacggccagcacgccgaaaacctcaac
atgaagcagcagttccctctctttgtcatccacaacgcgacctcagacctcaagtacggt
ctcccacagttgtccgacgaggaagtctcggcgggcaccgcggtgaccatcaaggaggcc
gacatcgagaagttcgtcgtggactttttggactccaagattgagcctattatcaagtct
gaggatgtcccagaggtccaggagagcagtgtttacaagctagtcgccaccacccacgac
caaattgtcaaggacgaggacaaggatgtgcttgttaagtactacgccccatggtgcggc
cactgcaagaagatggccccaacctttgaggagcttgcggatgtctacgccaacgacgag
gatgcgaagaacaaggtcctaatcgccgacatcgacgccaccttgaacgatgttcacggc
gtggtgatcgagggcttccccaccatcgttctataccccgccggcaaggactctacgccg
gttgtataccagcgctcccgctccttggaggagttcctagacttcatcaaggaggagggt
acccacaaggtggacggccaggccatccacgcgcgtaatgccgagactgctgccgataag
cccgccgagaaagccgaggccgaggccgaagacgccgacttggagcgcgatgagttgtaa

DBGET integrated database retrieval system