KEGG   Ashbya gossypii (Eremothecium gossypii): AGOS_AFR718WHelp
Entry
AGOS_AFR718W      CDS       T00167                                 

Definition
AFR718Wp
Orthology
K09580  
protein disulfide-isomerase A1 [EC:5.3.4.1]
Organism
ago  Ashbya gossypii (Eremothecium gossypii)
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:ago00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    AGOS_AFR718W
Enzymes [BR:ago01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     AGOS_AFR718W
Exosome [BR:ago04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   AGOS_AFR718W
  Exosomal proteins of colorectal cancer cells
   AGOS_AFR718W
  Exosomal proteins of bladder cancer cells
   AGOS_AFR718W
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
VI:1762567..1764126
Genome map
AA seq 519 aa AA seqDB search
MLFDKRFVLSIAGLLAQFAQAQDATAPEDSAVVKLTGETFGKFLEENPLVMAEFYAPWCG
HCKHLAPEYVKAAGELAEKGIKLAQVDCEQELDLCAGQNVRGYPTLKVFHSGASEEGMPY
TGARKAEEIVAYMLRQAEPAVTVLEGKEAAQDLEDLLAESKTAVVVDGGVKGLNESFYEL
ANLLRNDFVFVQYPTKKPTLAVHLPGEKEPIVFEGKNTTLPHLVDWISVESLPYFGEVDA
ITYQKYMTSDLPLAYFFYSSEEEREQYAGLFRKLGKAHRGSLNFAGLDAVKYGQHAENLN
MKQQFPLFVIHNATSDLKYGLPQLSDEEVSAGTAVTIKEADIEKFVVDFLDSKIEPIIKS
EDVPEVQESSVYKLVATTHDQIVKDEDKDVLVKYYAPWCGHCKKMAPTFEELADVYANDE
DAKNKVLIADIDATLNDVHGVVIEGFPTIVLYPAGKDSTPVVYQRSRSLEEFLDFIKEEG
THKVDGQAIHARNAETAADKPAEKAEAEAEDADLERDEL
NT seq 1560 nt NT seq  +upstreamnt  +downstreamnt
atgctttttgacaagcggtttgtgttgtccatcgccgggttgctggcacagtttgcacag
gcccaagatgccactgcaccagaggactctgcagtggtcaagttgaccggagagacgttc
gggaagttcttagaggagaacccgcttgtgatggcggagttttatgcgccatggtgtggc
cactgtaagcacctggcaccggagtacgtgaaggcggctggggagctggccgagaagggc
atcaagctggcgcaggtggactgcgagcaggagctggatctatgcgcgggccagaacgtg
cgcgggtacccgacgctgaaggtgttccacagtggggcgtcagaggagggcatgccatac
acgggcgcacgcaaggccgaggaaattgtggcgtacatgctgcgccaggccgagccggcc
gtgacggtgctggagggcaaggaggccgcccaggacctggaggacctgcttgcggagtcc
aagaccgcagtggtggttgacggtggcgtgaagggcctgaacgagtccttttacgaactg
gccaacctgctccggaacgactttgtatttgtgcagtacccaactaagaagccgaccttg
gcggtccacttgccgggcgagaaggagccaattgtgttcgagggtaagaacaccacgctt
cctcaccttgtcgactggatctccgtcgagagcctgccttactttggcgaggtcgatgcg
atcacctatcagaagtacatgacctcagacctgcctttggcttacttcttctactcttcc
gaggaggagcgcgagcaatacgcaggcctcttccgcaagctgggcaaggcgcaccgtggc
tccctaaactttgctggcctagacgccgtcaagtacggccagcacgccgaaaacctcaac
atgaagcagcagttccctctctttgtcatccacaacgcgacctcagacctcaagtacggt
ctcccacagttgtccgacgaggaagtctcggcgggcaccgcggtgaccatcaaggaggcc
gacatcgagaagttcgtcgtggactttttggactccaagattgagcctattatcaagtct
gaggatgtcccagaggtccaggagagcagtgtttacaagctagtcgccaccacccacgac
caaattgtcaaggacgaggacaaggatgtgcttgttaagtactacgccccatggtgcggc
cactgcaagaagatggccccaacctttgaggagcttgcggatgtctacgccaacgacgag
gatgcgaagaacaaggtcctaatcgccgacatcgacgccaccttgaacgatgttcacggc
gtggtgatcgagggcttccccaccatcgttctataccccgccggcaaggactctacgccg
gttgtataccagcgctcccgctccttggaggagttcctagacttcatcaaggaggagggt
acccacaaggtggacggccaggccatccacgcgcgtaatgccgagactgctgccgataag
cccgccgagaaagccgaggccgaggccgaagacgccgacttggagcgcgatgagttgtaa

DBGET integrated database retrieval system