KEGG   Ashbya gossypii (Eremothecium gossypii): AGOS_AGL001WHelp
Entry
AGOS_AGL001W      CDS       T00167                                 

Definition
AGL001Wp
Orthology
K11303  
histone acetyltransferase 1 [EC:2.3.1.48]
Organism
ago  Ashbya gossypii (Eremothecium gossypii)
Brite
Enzymes [BR:ago01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     AGOS_AGL001W
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
VII:1036882..1038057
Genome map
AA seq 391 aa AA seqDB search
MAEELKPELWTTSSNSALKLSLVNDENAVQFSPIFTYPIFGQAEQLFGYQDLNILLAFDS
VTFKPFLNIKYTKKLERGLDDVEGSILKFLPEGDVILKDEVEWVDAFNGEREKFALPNSE
SKVAEYTSGGESFAIFKVHLSDPNIRQLHRRMQIFTLLFIEAASYIDEDDSAWDIFMTFN
TSTRQCIGYTTTYKHWRYINGQEFDSSEKTTKRAKISQFIIFPPYQSKSHGSHLYSAAID
VWSKEEKISEVTVEDPNEAFDDLRDRCDFMRLSGSGLSSSIPEDVPIPRTWLTEQARKYK
LSLVQFTRLVEMILLYDNSPNFEIQVKARLYQKNHEVLTGMDSDTRKAKLQEAFTSLKED
YARILQKVPNRRRVLPSDEENAGESKRHKKE
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atggctgaagaattgaagccagagctatggactacgtctagcaattcagcattaaagttg
tcacttgttaatgatgaaaatgctgtccaattctcacctatattcacttatcctattttc
ggtcaagctgaacaactatttggctaccaagacctgaatatactactcgccttcgattca
gttacattcaaacccttcctcaacatcaaatataccaagaaacttgagcgtggacttgat
gatgttgaaggttccatattgaagttccttccagaaggagatgttatcttgaaagatgag
gtggagtgggtcgatgcgttcaatggtgaaagagagaaatttgctctaccaaacagtgaa
tcgaaagttgcagaatacacttctggcggagaatcgtttgccatttttaaggttcacttg
tcagaccctaacataagacagctgcatagacggatgcagatattcactcttctttttatc
gaagccgcatcctacatcgatgaggacgactccgcatgggatatttttatgacgttcaat
acatctactcgtcaatgtattggatacacaactacgtataagcactggaggtacatcaat
ggccaggaatttgacagctcagaaaagaccaccaagagggcaaagatatcccaattcata
atttttcctccatatcagtcaaagtcacatggtagtcatttgtattccgcggcgattgat
gtgtggtctaaagaggagaaaatatctgaagtgactgtagaagatccaaacgaagcgttt
gatgatcttagagatcgttgcgatttcatgagattgtctggttctggactatcaagctcg
attccagaagatgttcccataccgaggacgtggttaactgaacaagcacgcaaatacaag
ttatccctagtacaatttacgcggttagtagaaatgattctactatatgataattctcca
aatttcgaaatacaggtgaaggctagactgtatcagaaaaaccatgaggttttaacaggc
atggatagcgacacaaggaaagctaagctacaagaagcttttacttcgctgaaggaggac
tatgctcgtatattgcaaaaagtgcctaacagaagacgtgtactacctagtgatgaggaa
aacgcaggagagtctaagagacacaaaaaagagtag

DBGET integrated database retrieval system