KEGG   Ashbya gossypii (Eremothecium gossypii): AGOS_AGL057WHelp
Entry
AGOS_AGL057W      CDS       T00167                                 

Definition
AGL057Wp
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
ago  Ashbya gossypii (Eremothecium gossypii)
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:ago00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    AGOS_AGL057W
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    AGOS_AGL057W
Enzymes [BR:ago01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     AGOS_AGL057W
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
VII:920110..921783
Genome map
AA seq 557 aa AA seqDB search
MASVWRRSLKTLSSYPRPSGSSAKRFVEEQTTELEQLWSSPRFQEITRPYTPLDVVKHRG
SLGRVGYASSVQAERLHDLLEDKFHKREAVSTLGVIDPVQMTQLARCEGIEAAYVSGWAC
SSTMVGSTNEVSPDFGDYPYDTVPNQVERIFRAQQMHDRKAFLADGAEGRASTDYLKPII
ADGDMGHGGSTTVMKLAKLFAEKGAAAIHLEDQMHGGKRCGHLGGAVLAPTYVHISRLIA
TRLQWDIMGTQNLLIARTDSANAKLIASSSDPRDHEFILGTTQPAAQPWAELVLDMEAAG
CTAQEIAAAEQEWFDECPLLTFDQAAEQQLSSSEYGAYGARKKELCSQLGRPYLALREMR
HIAEAVAPHKSVNFDWDAPRTREGHHMLHGCMELAVRRTLAFAPYSDLLWLETKTPDLRQ
ASAFAAAIHRAYPHAKLVYNLSPSFNWTAHGYDDRQLRAFIPSLAAAGFVLQLVSLAGLH
SDALAFWQLAAAFPADGMLAYVQHVQAPERRSGCDVLLHQRWSGVDYVDSLGNLVQNGAS
SHTRGAGGDSFTESQFQ
NT seq 1674 nt NT seq  +upstreamnt  +downstreamnt
atggcaagtgtctggagaaggagtttaaagactctttcgagctacccaagaccgtccggt
tcctctgcaaagcgatttgtggaagagcagactactgaacttgagcaattatggtcttcg
cctcggttccaggaaattacgcgcccttatacgccacttgacgtggtaaaacatcgcggc
tcgctgggcagggttggttacgcatcgtcggtccaagcagagcgtctccacgacctactt
gaggacaaattccacaagagagaagcagtttcgaccctgggcgtgatcgacccggtccag
atgacccagcttgcaaggtgcgaagggatcgaagctgcatatgtatctggctgggcgtgt
tcctcgacgatggtcggctcgacaaacgaggtctccccggacttcggagactacccgtac
gataccgtgcccaaccaggtcgagcggatattcagggcgcagcagatgcacgacaggaag
gcgtttctcgcggacggggccgagggcagggccagcacggactacttgaaaccgataatt
gccgacggggatatgggccatggcggcagcacgaccgtcatgaagctggcgaagctgttt
gccgagaagggcgccgcggccatccacctcgaagaccagatgcacggcggcaagagatgc
gggcatctcggaggcgccgtgctggcgcccacctatgtacacatctcccgactcatcgcg
accagactgcagtgggacatcatgggcacccagaacctgctcattgcccgcacggactcc
gccaacgcgaagctcatagccagcagctcggacccgcgggaccatgagttcatcctgggc
accacgcaacccgctgctcagccctgggccgagcttgttcttgatatggaagctgctggc
tgcaccgctcaagaaattgcggctgccgagcaagaatggttcgacgagtgccccctactt
acctttgaccaggccgccgagcagcaactcagcagctccgaatacggcgcctacggggct
cggaagaaggagctttgctcccagctcggacggccgtatctggccctgcgagaaatgcgt
cacatcgccgaagccgttgccccgcacaagtccgtgaacttcgactgggacgccccgcgc
acgcgcgaggggcaccacatgctgcatggctgcatggagctcgccgtgcgcaggactctc
gccttcgcgccctacagcgacctgctgtggctagagacaaagaccccggacctccgccag
gcctccgccttcgctgccgccatccatcgcgcgtacccgcacgccaagcttgtctacaac
ctgtcgcccagcttcaattggactgcccacggctacgacgaccgccagctgcgcgccttc
atcccctcgctcgccgcagcgggctttgtgctccagctcgtttctctcgccggcctgcat
tccgacgccctggccttctggcagctggccgccgccttccccgccgacggcatgctggcc
tacgtccagcacgtgcaggcgcccgagcgtcgctcgggctgtgacgtgttactgcaccag
cgctggtcaggtgtggattacgtggactctctcggcaacctggtccaaaacggtgccagc
tcccacacccgcggcgcgggcggcgacagtttcaccgagtcccagttccagtaa

DBGET integrated database retrieval system