KEGG   Ashbya gossypii (Eremothecium gossypii): AGOS_AGL057WHelp
Entry
AGOS_AGL057W      CDS       T00167                                 

Definition
(RefSeq) AGL057Wp
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
ago  Ashbya gossypii (Eremothecium gossypii)
Pathway
ago00630  Glyoxylate and dicarboxylate metabolism
ago01100  Metabolic pathways
ago01110  Biosynthesis of secondary metabolites
ago01200  Carbon metabolism
Module
ago_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:ago00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    AGOS_AGL057W
Enzymes [BR:ago01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     AGOS_AGL057W
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ICL PEP_mutase
Motif
Other DBs
NCBI-GeneID: 4622908
NCBI-ProteinID: NP_986609
UniProt: Q750K8
Position
VII:920110..921783
Genome map
AA seq 557 aa AA seqDB search
MASVWRRSLKTLSSYPRPSGSSAKRFVEEQTTELEQLWSSPRFQEITRPYTPLDVVKHRG
SLGRVGYASSVQAERLHDLLEDKFHKREAVSTLGVIDPVQMTQLARCEGIEAAYVSGWAC
SSTMVGSTNEVSPDFGDYPYDTVPNQVERIFRAQQMHDRKAFLADGAEGRASTDYLKPII
ADGDMGHGGSTTVMKLAKLFAEKGAAAIHLEDQMHGGKRCGHLGGAVLAPTYVHISRLIA
TRLQWDIMGTQNLLIARTDSANAKLIASSSDPRDHEFILGTTQPAAQPWAELVLDMEAAG
CTAQEIAAAEQEWFDECPLLTFDQAAEQQLSSSEYGAYGARKKELCSQLGRPYLALREMR
HIAEAVAPHKSVNFDWDAPRTREGHHMLHGCMELAVRRTLAFAPYSDLLWLETKTPDLRQ
ASAFAAAIHRAYPHAKLVYNLSPSFNWTAHGYDDRQLRAFIPSLAAAGFVLQLVSLAGLH
SDALAFWQLAAAFPADGMLAYVQHVQAPERRSGCDVLLHQRWSGVDYVDSLGNLVQNGAS
SHTRGAGGDSFTESQFQ
NT seq 1674 nt NT seq  +upstreamnt  +downstreamnt
atggcaagtgtctggagaaggagtttaaagactctttcgagctacccaagaccgtccggt
tcctctgcaaagcgatttgtggaagagcagactactgaacttgagcaattatggtcttcg
cctcggttccaggaaattacgcgcccttatacgccacttgacgtggtaaaacatcgcggc
tcgctgggcagggttggttacgcatcgtcggtccaagcagagcgtctccacgacctactt
gaggacaaattccacaagagagaagcagtttcgaccctgggcgtgatcgacccggtccag
atgacccagcttgcaaggtgcgaagggatcgaagctgcatatgtatctggctgggcgtgt
tcctcgacgatggtcggctcgacaaacgaggtctccccggacttcggagactacccgtac
gataccgtgcccaaccaggtcgagcggatattcagggcgcagcagatgcacgacaggaag
gcgtttctcgcggacggggccgagggcagggccagcacggactacttgaaaccgataatt
gccgacggggatatgggccatggcggcagcacgaccgtcatgaagctggcgaagctgttt
gccgagaagggcgccgcggccatccacctcgaagaccagatgcacggcggcaagagatgc
gggcatctcggaggcgccgtgctggcgcccacctatgtacacatctcccgactcatcgcg
accagactgcagtgggacatcatgggcacccagaacctgctcattgcccgcacggactcc
gccaacgcgaagctcatagccagcagctcggacccgcgggaccatgagttcatcctgggc
accacgcaacccgctgctcagccctgggccgagcttgttcttgatatggaagctgctggc
tgcaccgctcaagaaattgcggctgccgagcaagaatggttcgacgagtgccccctactt
acctttgaccaggccgccgagcagcaactcagcagctccgaatacggcgcctacggggct
cggaagaaggagctttgctcccagctcggacggccgtatctggccctgcgagaaatgcgt
cacatcgccgaagccgttgccccgcacaagtccgtgaacttcgactgggacgccccgcgc
acgcgcgaggggcaccacatgctgcatggctgcatggagctcgccgtgcgcaggactctc
gccttcgcgccctacagcgacctgctgtggctagagacaaagaccccggacctccgccag
gcctccgccttcgctgccgccatccatcgcgcgtacccgcacgccaagcttgtctacaac
ctgtcgcccagcttcaattggactgcccacggctacgacgaccgccagctgcgcgccttc
atcccctcgctcgccgcagcgggctttgtgctccagctcgtttctctcgccggcctgcat
tccgacgccctggccttctggcagctggccgccgccttccccgccgacggcatgctggcc
tacgtccagcacgtgcaggcgcccgagcgtcgctcgggctgtgacgtgttactgcaccag
cgctggtcaggtgtggattacgtggactctctcggcaacctggtccaaaacggtgccagc
tcccacacccgcggcgcgggcggcgacagtttcaccgagtcccagttccagtaa

DBGET integrated database retrieval system