KEGG   Ashbya gossypii (Eremothecium gossypii): AGOS_AGL082WHelp
Entry
AGOS_AGL082W      CDS       T00167                                 

Definition
AGL082Wp
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
ago  Ashbya gossypii (Eremothecium gossypii)
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ago00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    AGOS_AGL082W
   00052 Galactose metabolism
    AGOS_AGL082W
   00500 Starch and sucrose metabolism
    AGOS_AGL082W
   00520 Amino sugar and nucleotide sugar metabolism
    AGOS_AGL082W
Enzymes [BR:ago01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     AGOS_AGL082W
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
VII:866907..868406
Genome map
AA seq 499 aa AA seqDB search
MLSVGRKHNKTHSTYAFESNTNNVAASQMRNVLNKLADSVKDEKTRCRFENELDSFFTLF
RRYLVEKSSDTTLEWEKIKSPSAEEVTAYSDIGASENLASLEKLAVLKLNGGLGTSMGCV
GPKSVIEVRDGNTFLDLSVRQIEYLNRQYDSDVPLLLMNSFNTDADTEHLIKKYSANRIR
IRSFNQSRFPRVYRDSLLPVPQDYNDKLDAWYPPGHGDLFEALHASGELDALLAQGREIL
FVSNGDNLGATVDLKILNHMIETGAEYIMELTDKTRADVKGGTLISYEGQVRLLEVAQVP
KEHIDEFKNIRKFTNFNTNNLWINLKAIKRLVESSSLTMEIIPNKKTITRNGNEIEVLQL
ETACGAAIRHFKGAHGVVVPRSRFLPVKTCSDLLLVKSDLFYLEHGALKLDPSRFGPNPL
IKLGSHFKKVSGFNAHIPHIPKIIELDHLTITGNVYLGKNVTLKGTVIVVCSDGQRIDIP
NGSVLENVVITGNLQILEH
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgttgtcggtaggcagaaaacacaataagacgcactcgacgtatgcgttcgagtcgaac
acgaacaacgttgcggcatcgcagatgcgcaacgtgctgaacaagctggcggactcggtc
aaagacgagaagacgcggtgccggttcgagaacgagttggactcgttcttcacgctgttc
cgtcggtacctagtggagaagtcgtcggacacgacgctggagtgggagaagatcaagtct
ccgagcgcggaggaggtgacggcgtactcggacatcggggcgtcggagaacttggcgagc
ctggagaagctggcggtgctgaagctgaacggtgggctgggcacgtcgatggggtgcgtc
gggccaaagtcggtgattgaggtgcgggacggcaacacgttcctggacctctctgtgcgg
cagatcgagtacctgaaccggcagtacgactcggatgtcccgctgttgctgatgaactcg
ttcaacacggacgcagacacggaacacctgatcaagaagtactcggcgaaccggatccgg
atccgctcgttcaaccagtcgcgcttcccccgcgtgtaccgcgactcgctgttgccagtt
ccacaggactacaacgacaagctggacgcgtggtaccctccagggcacggtgacctgttc
gaggcactgcacgcctcgggcgagctggacgcgctgttggcacagggcagggagatcctg
tttgtgtcaaacggtgacaatctgggcgccactgttgacctgaagatcctcaaccatatg
atcgagactggcgccgagtacatcatggagctcaccgacaagacgcgcgcggacgtgaag
ggtggcactctaataagctacgagggacaggtgcgcctgcttgaggttgctcaggttcca
aaggagcacatcgacgagttcaagaacattcgcaagttcacgaattttaacacgaacaac
ctgtggatcaacttgaaggccatcaagcgtttggttgagtcttcttccctaaccatggag
attatccccaacaagaagactatcaccagaaacggcaacgagattgaggtgctgcagctc
gagaccgcttgcggtgccgccatccgtcacttcaagggtgctcatggtgttgtggtccct
cgctcgcgcttcttgccggtcaagacttgctctgatctattgttagtcaagtccgatctc
ttctacctagagcatggggctttgaagctcgacccatcccgcttcgggcctaacccgctc
atcaagctcggctctcacttcaagaaagtgtccggtttcaacgcgcacattcctcatatc
cccaagatcatcgagcttgaccacctcaccatcactggtaacgtttacttgggcaagaat
gtcacgctaaagggcactgtcatcgtcgtttgctctgacgggcaaagaattgacattcca
aacggctccgtcttggaaaacgttgttatcacgggtaacttgcaaatcttggaacactga

DBGET integrated database retrieval system